Total number of results for Theromyzon tessulatum are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP03171 | IPEPYVWD |
8 | Theromyzon tessulatum | NA | leech osmoregulatory factor | 9037546#Salzet M, Vandenbulcke F, Verger-Bocquet M#Structural characterization of osmoregulator peptides from the brain of the leech Theromyzon tessulatum: IPEPYVWD and IPEPYVWD-amide#Brain Res Mol Brain Res 1996 Dec 31;43(1-2):301-10 | |
| NP03588 | GSGVSNGGTEMIQLSHIRERQRYWAQDNLRRRFLEK |
36 | Theromyzon tessulatum | NA | Egg-laying-like hormone | 9387880#Salzet M., Verger-Bocquet M., Vandenbulcke F., van Minnen J.; #Leech egg-laying-like hormone: structure, neuronal distribution and phylogeny.; #Brain Res. Mol. Brain Res. 49:211-221(1997). | |
| NP04067 | YGGFM |
5 | Theromyzon tessulatum | Opioid | Met-enkephalin | 7805888#Salzet M, Bulet P, Verger-Bocquet M, Malecha J#Isolation and structural characterization of enkephalins in the brain of the rhynchobdellid leech Theromyzon tessulatum#FEBS Lett 1995 Jan 3;357(2):187-91 |