Total number of results for Rana temporaria are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00806 | RPPGFSPFR |
9 | Rana temporaria | Bradykinin | Bradykinin | 19428766#Zhou X, Wang L, Zhou M, Chen T, Ding A, Rao P, Walker B, Shaw C#Amolopkinins W1 and W2--novel bradykinin-related peptides (BRPs) from the skin of the Chinese torrent frog, Amolops wuyiensis: antagonists of bradykinin-induced smooth muscle contraction of the rat ileum#Peptides 2009 May;30(5):893-900 | |
| NP03914 | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
36 | Rana temporaria | NPY | Melanostatin | 1539111#McKay D.M., Shaw C., Halton D.W., Thim L., Buchanan K.D.; #The primary structure and tissue distribution of an amphibian neuropeptide Y.; #Regul. Pept. 37:143-153(1992). | |
| NP03933 | APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF |
36 | Rana temporaria | NPY | Pancreatic polypeptide | 2091068#McKay DM, Shaw C, Thim L, Johnston CF, Halton DW, Fairweather I, Buchanan KD#The complete primary structure of pancreatic polypeptide from the European common frog, Rana temporaria#Regul Pept 1990 Dec 10;31(3):187-97 |