Total number of results for Oreochromis niloticus are 2
				
				
					Download
						as  Fasta  All
				
			| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF | 
|---|---|---|---|---|---|---|---|
| NP02698 | VGGPQHLCGSHLVDALYLVCGDRGFFYNPR | 30 | Oreochromis niloticus | Insulin | Insulin B chain | 7656183#Nguyen T.M., Wright J.R. Jr., Nielsen P.F., Conlon J.M.#Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.# Comp. Biochem. Physiol. 111C:33-44(1995). | |
| NP02699 | GIVEECCHKPCTIFDLQNYCN | 21 | Oreochromis niloticus | Insulin | Insulin A chain | 7656183#Nguyen T.M., Wright J.R. Jr., Nielsen P.F., Conlon J.M.#Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.# Comp. Biochem. Physiol. 111C:33-44(1995). | 
