Total number of results for Moniezia expansa are 2
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP01850 | GNFFRF |
6 | Moniezia expansa | FMRFamide related peptide | FMRFamide-like neuropeptide GNFFRF-amide | 8323531#Maule A.G., Shaw C., Halton D.W., Thim L.; #GNFFRFamide: a novel FMRFamide-immunoreactive peptide isolated from the sheep tapeworm, Moniezia expansa.; #Biochem. Biophys. Res. Commun. 193:1054-1060(1993). | |
NP03900 | PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF |
39 | Moniezia expansa | NPY | Neuropeptide F | #Maule A.G., Shaw C., Halton D.W., Thim L., Johnston C.F., Fairweather I., Buchanan K.D.; #Neuropeptide F: a novel parasitic flatworm regulatory peptide from Moniezia expansa (Cestoda: Cyclophyllidea).; #Parasitology 102:309-316(1991). |