Total number of results for Manduca sexta are 34
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00110 | ELTFTSSWG |
9 | Manduca sexta | AKH/HRTH/RPCH | Adipokinetic hormone | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00179 | QLTFTSSWG |
9 | Manduca sexta | AKH/HRTH/RPCH | Adipokinetic hormone | 4074373#Ziegler R., Eckart K., Schwarz H., Keller R.; #Amino acid sequence of Manduca sexta adipokinetic hormone elucidated by combined fast atom bombardment (FAB)/tandem mass spectrometry.; #Biochem. Biophys. Res. Commun. 133:337-342(1985). | |
| NP00180 | QLTFTSSWGGKRAMTNSISCRNDEAIAAIYKAIQNEAERFIMCQKN |
46 | Manduca sexta | AKH/HRTH/RPCH | Adipokinetic prohormone | ||
| NP00451 | EVRFRQCYFNPISCF |
15 | Manduca sexta | Allatostatin | Allatostatin | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00452 | AYSYVSEYKRLPVYNFGL |
18 | Manduca sexta | Allatostatin | Cydiastatin 2 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00453 | LPVYNFGL |
8 | Manduca sexta | Allatostatin | Cydiastatin 2 11–18 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00454 | SRPYSFGL |
8 | Manduca sexta | Allatostatin | Cydiastatin 3 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00455 | ARPYSFGL |
8 | Manduca sexta | Allatostatin | Cydiastatin 4 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00456 | SPHYDFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-1 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00457 | ARAYDFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-5 | 14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74 | |
| NP00458 | LPMYNFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-6 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00459 | ARSYNFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-7 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00460 | ERDMHRFSFGL |
11 | Manduca sexta | Allatostatin | Helicostatin-9 | 14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74 | |
| NP00461 | GWQDLNSAW |
9 | Manduca sexta | Allatostatin | Mas-MIP II | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00462 | AWQDLNSAW |
9 | Manduca sexta | Allatostatin | Mas-MIP1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00463 | APEKWAAFHGSW |
12 | Manduca sexta | Allatostatin | MIP III | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00464 | GWQDMSSAW |
9 | Manduca sexta | Allatostatin | MIP V | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00465 | AWSALHGAW |
9 | Manduca sexta | Allatostatin | MIP VI | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00585 | QVRFRQCYFNPISCF |
15 | Manduca sexta | Allatostatin | Allatostatin | 1946359#Kramer S.J., Toschi A., Miller C.A., Kataoka H., Quistad G.B., Li J.P., Carney R.L., Schooley D.A.; #Identification of an allatostatin from the tobacco hornworm Manduca sexta.; #Proc. Natl. Acad. Sci. U.S.A. 88:9458-9462(1991). | |
| NP00895 | PFCNAFTGC |
9 | Manduca sexta | CCAP | Cardioactive peptide | 1426284#Cheung C.C., Loi P.K., Sylwester A.W., Lee T.D., Tublitz N.J.; #Primary structure of a cardioactive neuropeptide from the tobacco hawkmoth, Manduca sexta.; #FEBS Lett. 313:165-168(1992). | |
| NP01035 | ETFQYSRGWTN |
11 | Manduca sexta | Corazonin | Corazonin | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP01218 | FLRF |
4 | Manduca sexta | FMRFamide related peptide | FLRFamide | 9828051#Miao Y, Waters EM, Witten JL#Developmental and regional-specific expression of FLRFamide peptides in the tobacco hornworm, Manduca sexta, suggests functions at ecdysis#J Neurobiol 1998 Nov 15;37(3):469-85 | |
| NP01219 | YAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRF |
39 | Manduca sexta | FMRFamide related peptide | FLRFamide | 9359469#Kingan TG, Zitnan D, Jaffe H, Beckage NE#Identification of neuropeptides in the midgut of parasitized insects: FLRFamides as candidate paracrines#Mol Cell Endocrinol 1997 Sep 30;133(1):19-32 | |
| NP01220 | FMRF |
4 | Manduca sexta | FMRFamide related peptide | FMRFamide | 2909410#Copenhaver PF, Taghert PH#Development of the enteric nervous system in the moth#I Diversity of cell types and the embryonic expression of FMRFamide-related neuropeptides Dev Biol 1989 Jan;131(1):70-84 | |
| NP01523 | EDVVHSFLRF |
10 | Manduca sexta | FMRFamide related peptide | FLRFamide I | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP01524 | GNSFLRF |
7 | Manduca sexta | FMRFamide related peptide | FLRFamide II | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP01525 | DPSFLRF |
7 | Manduca sexta | FMRFamide related peptide | FLRFamide III | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP01840 | QDVVHSFLRF |
10 | Manduca sexta | FMRFamide related peptide | Myosuppressin | 2235684#Kingan T.G., Teplow D.B., Phillips J.M., Riehm J.P., Rao K.R., Hildebrand J.G., Homberg U., Kammer A.E., Jardine I., Griffin P.R., Hunt D.F.; #A new peptide in the FMRFamide family isolated from the CNS of the hawkmoth, Manduca sexta.; #Peptides 11:849-856(1990). | |
| NP03134 | AKSYNFGL |
8 | Manduca sexta | NA | AKSYNFGLamide | 9268127#Davis NT, Veenstra JA, Feyereisen R, Hildebrand JG#Allatostatin-like-immunoreactive neurons of the tobacco hornworm, Manduca sexta, and isolation and identification of a new neuropeptide related to cockroach allatostatins#J Comp Neurol 1997 Aug 25;385(2):265-84 | |
| NP03564 | GFKNVEMMTARGF |
13 | Manduca sexta | NA | Allatotropin | 17839751#Kataoka H., Toschi A., Li J.P., Carney R.L., Schooley D.A., Kramer S.J.; #Identification of an allatotropin from adult Manduca Sexta.; #Science 243:1481-1483(1989). | |
| NP04445 | ELYAFPRV |
8 | Manduca sexta | Periviscerokinin | Cardioacceleratory Peptide 2b | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP04446 | DGVLNLYPFPRV |
12 | Manduca sexta | Periviscerokinin | Periviscerokinin-1 | 19350635#Herbert Z, Pollák E, Zougman A, Boros A, Kapan N, Molnár L#Identification of novel neuropeptides in the ventral nerve cord ganglia and their targets in an annelid worm, Eisenia fetida#J Comp Neurol 2009 Jun 10;514(5):415-32 | |
| NP04447 | QLYAFPRV |
8 | Manduca sexta | Periviscerokinin | Periviscerokinin-2 | 19350635#Herbert Z, Pollák E, Zougman A, Boros A, Kapan N, Molnár L#Identification of novel neuropeptides in the ventral nerve cord ganglia and their targets in an annelid worm, Eisenia fetida#J Comp Neurol 2009 Jun 10;514(5):415-32 | |
| NP04988 | TEGPGMWFGPRL |
12 | Manduca sexta | Pyrokinin | Pyrokinin | 19350635#Herbert Z, Pollák E, Zougman A, Boros A, Kapan N, Molnár L#Identification of novel neuropeptides in the ventral nerve cord ganglia and their targets in an annelid worm, Eisenia fetida#J Comp Neurol 2009 Jun 10;514(5):415-32 |