Total number of results for Lophius americanus are 9
				
				
					Download
						as  Fasta  All
				
			| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF | 
|---|---|---|---|---|---|---|---|
| NP02351 | QEADPSSSLEADSTLKDEPRELSNM | 25 | Lophius americanus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
| NP02352 | HSEGTFSNDYSKYLEDRKAQEFVRWLMNN | 29 | Lophius americanus | Glucagon | Glucagon-1 | 3058456#Nichols R., Lee T.D., Andrews P.C.#Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I.# Endocrinology 123:2639-2645(1988). | |
| NP02353 | HADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE | 34 | Lophius americanus | Glucagon | Glucagon-like peptide 1 (By similarity) | 3058456#Nichols R., Lee T.D., Andrews P.C.#Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I.# Endocrinology 123:2639-2645(1988). | |
| NP02354 | MPDQDPDRNSMLLNENSMLTEPIEPLNM | 28 | Lophius americanus | Glucagon | Glicentin-related polypeptide | ||
| NP02355 | HSEGTFSNDYSKYLETRRAQDFVQWLKNS | 29 | Lophius americanus | Glucagon | Glucagon-2 | ||
| NP02356 | HADGTYTSDVSSYLQDQAAKDFVSWLKAGRG | 31 | Lophius americanus | Glucagon | Glucagon-like peptide 2 | ||
| NP02675 | VAPAQHLCGSHLVDALYLVCGDRGFFYNP | 29 | Lophius americanus | Insulin | Insulin B chain | ||
| NP02676 | GIVEQCCHRPCNIFDLQNYCN | 21 | Lophius americanus | Insulin | Insulin A chain | ||
| NP05392 | AGCKNFFWKTFTSC | 14 | Lophius americanus | Somastostatin | Somatostatin-14 | 387385#Noe B.D., Spiess J., Rivier J.E., Vale W.#Isolation and characterization of somatostatin from anglerfish pancreatic islet.# Endocrinology 105:1410-1415(1979). | 
