Total number of results for Locusta migratoria are 48
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00067 | YADPNADPMAFL |
12 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic Hormone Joining Peptide 2 | 11897382#Baggerman G, Huybrechts J, Clynen E, Hens K, Harthoorn L, Van der Horst D, Poulos C, De Loof A, Schoofs L#New insights in Adipokinetic Hormone (AKH) precursor processing in Locusta migratoria obtained by capillary liquid chromatography-tandem mass spectrometry#Peptides 2002 Apr;23(4):635-44 | |
NP00166 | QLNFTPNWGT |
10 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic hormone 1 | 958472#Stone J.V., Mordue W., Batley K.E., Morris H.R.; #Structure of locust adipokinetic hormone, a neurohormone that regulates lipid utilisation during flight.; #Nature 263:207-211(1976). | |
NP00167 | DAADFADPYSFLYRLIQAEARKMSGCSN |
28 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic hormone precursor-related peptide alpha chain | 2731552#Hietter H., Luu B., Goltzene F., Zachary D., Hoffmann J.A., van Dorsselaer A.; #Isolation and structure of two novel 6-kDa dimeric peptides from the corpora cardiaca of the insect Locusta migratoria. Molecular mass determination by mass spectrometry.; #Eur. J. Biochem. 182:77-84(1989). | |
NP00168 | QLNFTPNWGTGKRDAADFADPYSFLYRLIQAEARKMSGCSN |
41 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic prohormone type 1 | ||
NP00169 | QLNFSAGW |
8 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic hormone 2 | 4063072# Siegert K., Morgan P., Mordue W.; #Primary structures of locust adipokinetic hormones II.; # Biol. Chem. Hoppe-Seyler 366:723-727(1985).$3947348#Gaede G., Goldsworthy G.J., Schaffer M.H., Cook J.C., Rinehart K.L. Jr.; #Sequence analyses of adipokinetic hormones II from corpora cardiaca of Schistocerca nitans, Schistocerca gregaria, and Locusta migratoria by fast atom bombardment mass spectrometry.; #Biochem. Biophys. Res. Commun. 134:723-730(1986). | |
NP00170 | YADPNADPMAFLYRLIQIEARKLAGCSD |
28 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic hormone precursor-related peptide beta chain | 2731552#Hietter H., Luu B., Goltzene F., Zachary D., Hoffmann J.A., van Dorsselaer A.; #Isolation and structure of two novel 6-kDa dimeric peptides from the corpora cardiaca of the insect Locusta migratoria. Molecular mass determination by mass spectrometry.; #Eur. J. Biochem. 182:77-84(1989). | |
NP00171 | QLNFSAGWGRRYADPNADPMAFLYRLIQIEARKLAGCSD |
39 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic prohormone type 2 | ||
NP00172 | QLNFTPWW |
8 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic hormone 3 | 1997320#Oudejans R.C.H.M., Kooiman F.P., Heerma W., Versluis C., Slotboom A.J., Beenakkers A.M.T.; #Isolation and structure elucidation of a novel adipokinetic hormone (Lom-AKH-III) from the glandular lobes of the corpus cardiacum of the migratory locust, Locusta migratoria.; #Eur. J. Biochem. 195:351-359(1991). | |
NP00173 | ALGAPAAGDCVSASPQALLSILNAAQAEVQKLIDCSRFTSEANS |
44 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic hormone precursor-related peptide gamma chain | ||
NP00174 | QLNFTPWWGKRALGAPAAGDCVSASPQALLSILNAAQAEVQKLIDCSRFTSEANS |
55 | Locusta migratoria | AKH/HRTH/RPCH | Adipokinetic prohormone type 3 | ||
NP00175 | QVTFSRDWSP |
10 | Locusta migratoria | AKH/HRTH/RPCH | Hypertrehalosaemic hormone | 10214953#Siegert K.J.; #Locust corpora cardiaca contain an inactive adipokinetic hormone.; #FEBS Lett. 447:237-240(1999). | |
NP00584 | AWQDLNAGW |
9 | Locusta migratoria | Allatostatin | Locustamyoinhibiting peptide | 1796179#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, identification and synthesis of locustamyoinhibiting peptide (LOM-MIP), a novel biologically active neuropeptide from Locusta migratoria.; #Regul. Pept. 36:111-119(1991). | |
NP00614 | EXYXKQSAFNAVS |
13 | Locusta migratoria | Arthropod CHH/MIH/GIH/VIH hormone | locustamyoinhibin | 7972937#Schoofs L, Veelaert D, Holman GM, Hayes TK, De Loof A#Partial identification, synthesis and immunolocalization of locustamyoinhibin, the third myoinhibiting neuropeptide isolated from Locusta migratoria#Regul Pept 1994 Jul 14;52(2):139-56 | |
NP01210 | ADVGHVFLRF |
10 | Locusta migratoria | FMRFamide related peptide | FMRFamide-related peptide | 11897379#Clark J, Lange AB#Evidence for the association of FMRFamide-related peptides with the spermatheca of Locusta migratoria#Peptides 2002 Apr;23(4):613-9 | |
NP01211 | GQERNFLRF |
9 | Locusta migratoria | FMRFamide related peptide | FMRFamide-related peptide | 11897379#Clark J, Lange AB#Evidence for the association of FMRFamide-related peptides with the spermatheca of Locusta migratoria#Peptides 2002 Apr;23(4):613-9 | |
NP01212 | LWENLRF |
7 | Locusta migratoria | FMRFamide related peptide | RFamide | 17707763#Hill SR, Orchard I#Isolation and sequencing of two FMRFamide-related peptides from the gut of Locusta migratoria L#Peptides 2007 Aug;28(8):1490-7 | |
NP01801 | PDVDHVFLRF |
10 | Locusta migratoria | FMRFamide related peptide | SchistoFLRFamide | 7687352#Schoofs L., Holman G.M., Paemen L., Veelaert D., Amelinckx M., de Loof A.; #Isolation, identification, and synthesis of PDVDHFLRFamide (SchistoFLRFamide) in Locusta migratoria and its association with the male accessory glands, the salivary glands, the heart, and the oviduct.; #Peptides 14:409-421(1993). | |
NP02127 | QLASDDYGHMRF |
12 | Locusta migratoria | Gastrin/cholecystokinin | Sulfakinin | #Schoofs L., Holman G.L., Hayes T.K., Nachman R.J., de Loof A.; ##(In) McCaffery A., Wilson I. (eds.); | |
NP02598 | GVFDECCRKSCSISELQTYCG |
21 | Locusta migratoria | Insulin | insulin-related peptide | 1935945#Hetru C, Li KW, Bulet P, Lagueux M, Hoffmann JA#Isolation and structural characterization of an insulin-related molecule, a predominant neuropeptide from Locusta migratoria#Eur J Biochem 1991 Oct 15;201(2):495-9 | |
NP02599 | SGAPQPVARYCGEKLSNALKLVCRGNYNTMF |
31 | Locusta migratoria | Insulin | insulin-related peptide | 1935945#Hetru C, Li KW, Bulet P, Lagueux M, Hoffmann JA#Isolation and structural characterization of an insulin-related molecule, a predominant neuropeptide from Locusta migratoria#Eur J Biochem 1991 Oct 15;201(2):495-9 | |
NP02797 | AFHSWG |
6 | Locusta migratoria | Kinin | Achetakinin V | 1585017#Schoofs L, Holman GM, Proost P, Van Damme J, Hayes TK, De Loof A#Locustakinin, a novel myotropic peptide from Locusta migratoria, isolation, primary structure and synthesis#Regul Pept 1992 Jan 2;37(1):49-57 | |
NP02822 | AFSSWG |
6 | Locusta migratoria | Kinin | Locustakinin-1 | 1585017#Schoofs L., Holman G.M., Proost P., van Damme J., Hayes T.K., de Loof A.; #Locustakinin, a novel myotropic peptide from Locusta migratoria, isolation, primary structure and synthesis.; #Regul. Pept. 37:49-57(1992). | |
NP03128 | RYLPT |
5 | Locusta migratoria | NA | Proctolin | 3794007#Lange AB, Orchard I, Adams ME#Peptidergic innervation of insect reproductive tissue: the association of proctolin with oviduct visceral musculature#J Comp Neurol 1986 Dec 15;254(3):279-86 | |
NP03555 | GFKNVALSTARGF |
13 | Locusta migratoria | NA | Lom-AG-myotropin-1 | 2052501#Paemen L., Tips A., Schoofs L., Proost P., van Damme J., de Loof A.; #Lom-AG-myotropin: a novel myotropic peptide from the male accessory glands of Locusta migratoria.; #Peptides 12:7-10(1991). | |
NP03556 | AHRFAAEDFGALDTA |
15 | Locusta migratoria | NA | Lom-AG-myotropin-2 | #Paemen L., Schoofs L., Proost P., Decock B., de Loof A.; #Isolation, identification and synthesis of Lom-AG-myotropin II, a novel peptide in the male accessory reproductive glands of Locusta migratoria.; #Insect Biochem. 21:243-248(1991). | |
NP03557 | NPISRSCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC |
83 | Locusta migratoria | NA | Neuroparsin-A | #Girardie J., Huet J.-C., Pernollet J.-C.; #The locust neuroparsin A: sequence and similarities with vertebrate and insect polypeptide hormones.; #Insect Biochem. 20:659-666(1990). | |
NP03558 | SCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGPYELHGKCGVGMDCRCGLCSGCSLHNLQCFFFEGGLPSSC |
78 | Locusta migratoria | NA | Neuroparsin-B | 2924926#Girardie J., Girardie A., Huet J.-C., Pernollet J.-C.; #Amino acid sequence of locust neuroparsins.; #FEBS Lett. 245:4-8(1989). | |
NP03894 | YSQVARPRF |
9 | Locusta migratoria | NPY | Neuropeptide F | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP03895 | SNRSPSLRLRF |
11 | Locusta migratoria | NPY | Short neuropeptide F | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP03896 | SPSLRLRF |
8 | Locusta migratoria | NPY | Short neuropeptide F4-11 | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP04582 | AAGLFQFPRV |
10 | Locusta migratoria | Periviscerokinin | Periviscerokinin-1 | 11897380#Predel R., Gaede G.; #Identification of the abundant neuropeptide from abdominal perisympathetic organs of locusts.; #Peptides 23:621-627(2002).$12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP04583 | GLLAFPRV |
8 | Locusta migratoria | Periviscerokinin | Periviscerokinin-2 | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP04951 | EDSGDGWPQQPFVPRL |
16 | Locusta migratoria | Pyrokinin | locustapyrokinin | 2026322#Schoofs L, Holman GM, Hayes TK, Nachman RJ, De Loof A#Isolation, primary structure, and synthesis of locustapyrokinin: a myotropic peptide of Locusta migratoria#Gen Comp Endocrinol 1991 Jan;81(1):97-104 | |
NP04952 | ESVPTFTPRL |
10 | Locusta migratoria | Pyrokinin | locustapyrokinin II | 7903606#Schoofs L, Holman GM, Nachman R, Proost P, Van Damme J, De Loof A#Isolation, identification and synthesis of locustapyrokinin II from Locusta migratoria, another member of the FXPRL-amide peptide family#Comp Biochem Physiol C 1993 Sep;106(1):103-9 | |
NP04983 | GAVPAAQWFSPRL |
13 | Locusta migratoria | Pyrokinin | Locustamyotropin-1 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
NP04984 | QDSGDEWPQQPFVPRL |
16 | Locusta migratoria | Pyrokinin | Locustapyrokinin-1 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
NP05119 | GAVPAAQFSPRL |
12 | Locusta migratoria | Pyrokinin | Locustamyotropin-1 | 1974346#Schoofs L., Holman G.M., Hayes T.K., Tips A., Nachman R.J., Vandesande F., de Loof A.; #Isolation, identification and synthesis of locustamyotropin (Lom-MT), a novel biologically active insect peptide.; #Peptides 11:427-433(1990). | |
NP05120 | EGDFTPRL |
8 | Locusta migratoria | Pyrokinin | Locustamyotropin-2 | #Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, identification and synthesis of locustamyotropin II, an additional neuropeptide of Locusta migratoria. Member of the cephalomyotropic peptide family.; #Insect Biochem. 20:479-484(1990). | |
NP05121 | RQQPFVPRL |
9 | Locusta migratoria | Pyrokinin | Locustamyotropin-3 | #Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., Kochansky J.P., de Loof A.; #Isolation, identification and synthesis of locustamyotropin III and IV, two additional neuropeptides of Locusta migratoria: members of the locustamyotropin peptide family.; #Insect Biochem. Mol. Biol. 22:447-452(1992). | |
NP05122 | RLHQNGMPFSPRL |
13 | Locusta migratoria | Pyrokinin | Locustamyotropin-4 | #Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., Kochansky J.P., de Loof A.; #Isolation, identification and synthesis of locustamyotropin III and IV, two additional neuropeptides of Locusta migratoria: members of the locustamyotropin peptide family.; #Insect Biochem. Mol. Biol. 22:447-452(1992). | |
NP05123 | QDSGDGWPQQPFVPRL |
16 | Locusta migratoria | Pyrokinin | Locustapyrokinin-1 | 2026322#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, primary structure, and synthesis of locustapyrokinin: a myotropic peptide of Locusta migratoria.; #Gen. Comp. Endocrinol. 81:97-104(1991). | |
NP05124 | QSVPTFTPRL |
10 | Locusta migratoria | Pyrokinin | Locustapyrokinin-2 | 7903606#Schoofs L., Holman G.M., Nachman R., Proost P., van Damme J., de Loof A.; #Isolation, identification and synthesis of locustapyrokinin II from Locusta migratoria, another member of the FXPRL-amide peptide family.; #Comp. Biochem. Physiol. 106C:103-109(1993). | |
NP05125 | DGGEPAAPLWFGPRV |
15 | Locusta migratoria | Pyrokinin | Pyrokinin | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP05694 | GPSGFYGVR |
9 | Locusta migratoria | Tachykinin | Locustatachykinin-1 | 2311766#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Locustatachykinin I and II, two novel insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #FEBS Lett. 261:397-401(1990). | |
NP05695 | APLSGFYGVR |
10 | Locusta migratoria | Tachykinin | Locustatachykinin-2 | 2311766#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Locustatachykinin I and II, two novel insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #FEBS Lett. 261:397-401(1990). | |
NP05696 | APQAGFYGVR |
10 | Locusta migratoria | Tachykinin | Locustatachykinin-3 | 2132575#Schoofs L., Holman G.M., Hayes T.K., Kochansky J.P., Nachman R.J., de Loof A.; #Locustatachykinin III and IV: two additional insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #Regul. Pept. 31:199-212(1990). | |
NP05697 | APSLGFHGVR |
10 | Locusta migratoria | Tachykinin | Locustatachykinin-4 | 2132575#Schoofs L., Holman G.M., Hayes T.K., Kochansky J.P., Nachman R.J., de Loof A.; #Locustatachykinin III and IV: two additional insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #Regul. Pept. 31:199-212(1990). | |
NP05824 | CLITNCPRG |
9 | Locusta migratoria | Vasopressin/oxytocin | Locupressin | 3689410#Proux J.P., Miller C.A., Li J.P., Carney R.L., Girardie A., Delaage M., Schooley D.A.; #Identification of an arginine vasopressin-like diuretic hormone from Locusta migratoria.; #Biochem. Biophys. Res. Commun. 149:180-186(1987). |