Total number of results for Helicoverpa zea are 12
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00064 | ELTFSSGWGN |
10 | Helicoverpa zea | AKH/HRTH/RPCH | neuropeptide hormone | 3415690#Jaffe H, Raina AK, Riley CT, Fraser BA, Bird TG, Tseng CM, Zhang YS, Hayes DK#Isolation and primary structure of a neuropeptide hormone from Heliothis zea with hypertrehalosemic and adipokinetic activities#Biochem Biophys Res Commun 1988 Aug 30;155(1):344-50 | |
NP00156 | QLTFTSSWG |
9 | Helicoverpa zea | AKH/HRTH/RPCH | Adipokinetic hormone | 3964263#Jaffe H., Raina A.K., Riley C.T., Fraser B.A., Holman G.M., Wagner R.M., Ridgway R.L., Hayes D.K.; #Isolation and primary structure of a peptide from the corpora cardiaca of Heliothis zea with adipokinetic activity.; #Biochem. Biophys. Res. Commun. 135:622-628(1986). | |
NP00157 | QLTFSSGWGN |
10 | Helicoverpa zea | AKH/HRTH/RPCH | Hypertrehalosaemic hormone | 3415690#Jaffe H., Raina A.K., Riley C.T., Fraser B.A., Bird T.G., Tseng C.M., Zhang Y.S., Hayes D.K.; #Isolation and primary structure of a neuropeptide hormone from Heliothis zea with hypertrehalosemic and adipokinetic activities.; #Biochem. Biophys. Res. Commun. 155:344-350(1988). | |
NP01190 | FMRF |
4 | Helicoverpa zea | FMRFamide related peptide | FMRFamide | 9692236#Huang Y, Brown MR, Lee TD, Crim JW#RF-amide peptides isolated from the midgut of the corn earworm, Helicoverpa zea, resemble pancreatic polypeptide#Insect Biochem Mol Biol 1998 May-Jun;28(5-6):345-56 | |
NP02813 | YFSPWG |
6 | Helicoverpa zea | Kinin | Hez-kinin-1 | 9350979#Predel R, Kellner R, Rapus J, Penzlin H, Gáde G#Isolation and structural elucidation of eight kinins from the retrocerebral complex of the American cockroach, Periplaneta americana#Regul Pept 1997 Aug 29;71(3):199-205 | |
NP02814 | VRFSPWG |
7 | Helicoverpa zea | Kinin | Hez-kinin-2 | 9350979#Predel R, Kellner R, Rapus J, Penzlin H, Gáde G#Isolation and structural elucidation of eight kinins from the retrocerebral complex of the American cockroach, Periplaneta americana#Regul Pept 1997 Aug 29;71(3):199-205 | |
NP02815 | KVKFSAWG |
8 | Helicoverpa zea | Kinin | Hez-kinin-3 | 9350979#Predel R, Kellner R, Rapus J, Penzlin H, Gáde G#Isolation and structural elucidation of eight kinins from the retrocerebral complex of the American cockroach, Periplaneta americana#Regul Pept 1997 Aug 29;71(3):199-205 | |
NP05095 | VIFTPKL |
7 | Helicoverpa zea | Pyrokinin | Alpha-SG neuropeptide (Potential) | ||
NP05096 | SLAYDDKSFENVEFTPRL |
18 | Helicoverpa zea | Pyrokinin | Beta-SG neuropeptide (Potential) | ||
NP05097 | NDVKDGAASGAHSDRLGLWFGPRL |
24 | Helicoverpa zea | Pyrokinin | Diapause hormone homolog (Potential) | ||
NP05098 | TMNFSPRL |
8 | Helicoverpa zea | Pyrokinin | Gamma-SG neuropeptide (Potential) | ||
NP05099 | LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL |
33 | Helicoverpa zea | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | 17802237#Raina A.K., Jaffe H., Kempe T.G., Keim P., Blacher R.W., Fales H.M., Riley C.T., Klun J.A., Ridgway R.L., Hayes D.K.; #Identification of a neuropeptide hormone that regulates sex pheromone production in female moths.; #Science 244:796-798(1989). |