Total number of results for Aplysia fasciata are 4
				
				
					Download
						as  Fasta  All
				
			| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF | 
|---|---|---|---|---|---|---|---|
| NP02970 | ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK | 36 | Aplysia fasciata | Molluscan ELH | Egg-laying hormone | 3226961#Nagle G.T., Painter S.D., Blankenship J.E., Choate J.V.A., Kurosky A.; #The bag cell egg-laying hormones of Aplysia brasiliana and Aplysia californica are identical.; #Peptides 9:867-872(1988). | |
| NP03514 | QVAQMHIWRAVNHDRHHSTGSGRHSRFLTRNRYRYGGGHLSDA | 43 | Aplysia fasciata | NA | Histidine-rich basic peptide | 2587425#Knock S.L., Nagle G.T., Lin C.Y., McAdoo D.J., Kurosky A.; #Aplysia brasiliana neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and its prohormone.; #Peptides 10:859-867(1989). | |
| NP03515 | EEVFDDTDVGDELTNALESVLTDLKD | 26 | Aplysia fasciata | NA | Peptide I | 2587425#Knock S.L., Nagle G.T., Lin C.Y., McAdoo D.J., Kurosky A.; #Aplysia brasiliana neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and its prohormone.; #Peptides 10:859-867(1989). | |
| NP03516 | DAEEPSAFMTRL | 12 | Aplysia fasciata | NA | Peptide II | 2587425#Knock S.L., Nagle G.T., Lin C.Y., McAdoo D.J., Kurosky A.; #Aplysia brasiliana neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and its prohormone.; #Peptides 10:859-867(1989). | 
