Total number of results for Crocodylus novaeguineae are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05436 |
LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHNASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIIGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC
|
199 | Crocodylus novaeguineae | Somatotropin/prolactin | Prolactin-1 | 1399264#Noso T., Swanson P., Lance V.A., Kawauchi H.#Isolation and characterization of glycosylated and non-glycosylated prolactins from alligator and crocodile.# Int. J. Pept. Protein Res. 39:250-257(1992). | |
| NP05437 |
LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIIGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC
|
199 | Crocodylus novaeguineae | Somatotropin/prolactin | Prolactin-2 | 1399264#Noso T., Swanson P., Lance V.A., Kawauchi H.#Isolation and characterization of glycosylated and non-glycosylated prolactins from alligator and crocodile.# Int. J. Pept. Protein Res. 39:250-257(1992). |