Total number of results for Ciona intestinalis are 42
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP02013 |
PAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
|
59 | Ciona intestinalis | Galanin | Ci-GALP | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02014 |
PFRGQGGWTLNSVGYNAGLGALRKLFE
|
27 | Ciona intestinalis | Galanin | Ci-GALP | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02015 |
GWTLNSAGYLLGPHAIDSHRSLGDKRGVA
|
29 | Ciona intestinalis | Galanin | Galanin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02016 |
GWTLNSAGYLLGPHAVDNHRSFNDKHGFT
|
29 | Ciona intestinalis | Galanin | Galanin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02017 |
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
|
30 | Ciona intestinalis | Galanin | Galanin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02084 |
NYYGWMDF
|
8 | Ciona intestinalis | Gastrin/cholecystokinin | Cionin | 2303439#Johnsen A.H., Rehfeld J.F.; #Cionin: a disulfotyrosyl hybrid of cholecystokinin and gastrin from the neural ganglion of the protochordate Ciona intestinalis.; #J. Biol. Chem. 265:3054-3058(1990). | |
NP02540 |
QHWSKGYSPG
|
10 | Ciona intestinalis | GnRH | t-GnRH-3 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02541 |
QHWSYEFMPG
|
10 | Ciona intestinalis | GnRH | t-GnRH-5 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02542 |
DPLTNIM
|
7 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02543 |
GEKESRPLSSYPGSV
|
15 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02544 |
QHWSYEYMPG
|
10 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02545 |
WLRYDA
|
6 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02547 |
QHWSNWWIPGAPGYNG
|
16 | Ciona intestinalis | GnRH | Ci-GnRH-X | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03348 |
FQSLF
|
5 | Ciona intestinalis | NA | Ci-LF-1 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03349 |
YPGFQGLF
|
8 | Ciona intestinalis | NA | Ci-LF-2 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03350 |
HNPHLPDLF
|
9 | Ciona intestinalis | NA | Ci-LF-3 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03351 |
YNSMGLF
|
7 | Ciona intestinalis | NA | Ci-LF-4 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03352 |
SPGMLGLF
|
8 | Ciona intestinalis | NA | Ci-LF-5 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03353 |
SDARLQGLF
|
9 | Ciona intestinalis | NA | Ci-LF-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03354 |
YPNFQGLF
|
8 | Ciona intestinalis | NA | Ci-LF-7 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03355 |
GFQNNAEGPV
|
10 | Ciona intestinalis | NA | Ci-LF-8 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03356 |
GNLHSLF
|
7 | Ciona intestinalis | NA | Ci-LF-8 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03357 |
SADLFGAPMYII
|
12 | Ciona intestinalis | NA | Ci-LF-8 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03358 |
QLHVPSIL
|
8 | Ciona intestinalis | NA | Ci-NTLP-1 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03359 |
MMLGPGIL
|
8 | Ciona intestinalis | NA | Ci-NTLP-2 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03360 |
GMMGPSII
|
8 | Ciona intestinalis | NA | Ci-NTLP-3 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03361 |
FGMIPSII
|
8 | Ciona intestinalis | NA | Ci-NTLP-4 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03362 |
NKLLYPSVI
|
9 | Ciona intestinalis | NA | Ci-NTLP-5 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03363 |
AVLHLAINEFQRL
|
13 | Ciona intestinalis | NA | Ci-NTLP-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03364 |
SRHPKLYFPGIV
|
12 | Ciona intestinalis | NA | Ci-NTLP-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03365 |
CFFRDCSNMDWYR
|
13 | Ciona intestinalis | NA | Ci-VP | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03366 |
DAARPNYYFL
|
10 | Ciona intestinalis | NA | Ci-YFL-1 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03367 |
ELVVRDPYFV
|
10 | Ciona intestinalis | NA | Ci-YFV-1 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03368 |
NNQESYFV
|
8 | Ciona intestinalis | NA | Ci-YFV-2 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03369 |
DDEPRSYFV
|
9 | Ciona intestinalis | NA | Ci-YFV-3 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03370 |
KNPYIL
|
6 | Ciona intestinalis | NA | LANT 6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03768 |
KIPYIL
|
6 | Ciona intestinalis | Neurotensin | Neuromedin N | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03769 |
QLHVNKARRPYIL
|
13 | Ciona intestinalis | Neurotensin | Neurotensin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP03770 |
QLYENKPRRPYIL
|
13 | Ciona intestinalis | Neurotensin | Neurotensin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP05561 |
HVRHFYGLM
|
9 | Ciona intestinalis | Tachykinin | Ci-TK-I | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP05562 |
NLLSLLQHAIETANNAYRSPR
|
21 | Ciona intestinalis | Tachykinin | Ci-TK-II | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP05563 |
SIGDQPSIFNERASFTGLM
|
19 | Ciona intestinalis | Tachykinin | Ci-TK-II | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 |