Total number of results for Ceratotherium simum are 1
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP03939 |
SPLEPVYPGDNATPEEMAQYAAELRRYINMLTRPRY
|
36 | Ceratotherium simum | NPY | Pancreatic hormone | 1808025#Henry J.S., Lance V.A., Conlon J.M.#Primary structure of pancreatic polypeptide from four species of Perissodactyla (Przewalski's horse, zebra, rhino, tapir).# Gen. Comp. Endocrinol. 84:440-446(1991). |