Total number of results for Camelus dromedarius are 6
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP02295 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Camelus dromedarius | Glucagon | Glucagon | 4421675#Sundby F., Markussen J., Danho W.#Camel glucagon: isolation, crystallization and amino acid composition.# Horm. Metab. Res. 6:425-425(1974). | |
NP02623 |
FANQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Camelus dromedarius | Insulin | Insulin B chain | #Danho W.O.#The isolation and characterization of insulin of camel (Camelus dromedarius).# J. Fac. Med. Baghdad 14:16-28(1972). | |
NP02624 |
GIVEQCCASVCSLYQLENYCN
|
21 | Camelus dromedarius | Insulin | Insulin A chain | #Danho W.O.#The isolation and characterization of insulin of camel (Camelus dromedarius).# J. Fac. Med. Baghdad 14:16-28(1972). | |
NP04730 |
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
|
31 | Camelus dromedarius | POMC | Beta-endorphin | 1063395#Li C.H., Chung D.#Isolation and structure of an untriakontapeptide with opiate activity from camel pituitary glands.# Proc. Natl. Acad. Sci. U.S.A. 73:1145-1148(1976). | |
NP04731 |
YGGFM
|
5 | Camelus dromedarius | POMC | Met-enkephalin | 1063395#Li C.H., Chung D.#Isolation and structure of an untriakontapeptide with opiate activity from camel pituitary glands.# Proc. Natl. Acad. Sci. U.S.A. 73:1145-1148(1976). | |
NP05430 |
LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFMTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLVLRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGVKENEIYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
|
199 | Camelus dromedarius | Somatotropin/prolactin | Prolactin | 2029533#Martinat N., Huet J.-C., Nespoulous C., Combarnous Y., Pernollet J.-C.#Determination of the primary and secondary structures of the dromedary (Camelus dromedarius) prolactin and comparison with prolactins from other species.# Biochim. Biophys. Acta 1077:339-345(1991). |