Total number of results for Somastostatin are 55
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05362 |
SVDNQQGRERKAGCKNFYWKGPTSC
|
25 | Anguilla anguilla | Somastostatin | Somatostatin-25 | 2904391#Conlon JM, Deacon CF, Hazon N, Henderson IW, Thim L#Somatostatin-related and glucagon-related peptides with unusual structural features from the European eel (Anguilla anguilla)#Gen Comp Endocrinol 1988 Nov;72(2):181-9 | |
| NP05363 |
SVESSNHLPARERKAGCKNFYWKGFTSC
|
28 | Carassius auratus | Somastostatin | Somatostatin-28 | 8536941#Uesaka T, Yano K, Yamasaki M, Ando M#Somatostatin-, vasoactive intestinal peptide-, and granulin-like peptides isolated from intestinal extracts of goldfish, Carassius auratus#Gen Comp Endocrinol 1995 Sep;99(3):298-306 | |
| NP05364 |
DNTVRSKPLNCMNYFWKSSTAC
|
22 | Ictalurus punctatus | Somastostatin | Somatostatin I | 7358665#Oyama H, Bradshaw RA, Bates OJ, Permutt A#Amino acid sequence of catfish pancreatic somatostatin I#J Biol Chem 1980 Mar 25;255(6):2251-4 | |
| NP05365 |
AGCKNFFWKTFTSC
|
14 | Lampetra fluviatilis | Somastostatin | Somatostatin 14 | 8575665#Conlon JM, Bondareva V, Rusakov Y, Plisetskaya EM, Mynarcik DC, Whittaker J#Characterization of insulin, glucagon, and somatostatin from the river lamprey, Lampetra fluviatilis#Gen Comp Endocrinol 1995 Oct;100(1):96-105 | |
| NP05366 |
PCKNFFWKTFSSCK
|
14 | NA | Somastostatin | Cortistatin | 12030609#Cassoni P, Muccioli G, Marrocco T, Volante M, Allia E, Ghigo E, Deghenghi R, Papotti M#Cortistatin-14 inhibits cell proliferation of human thyroid carcinoma cell lines of both follicular and parafollicular origin#J Endocrinol Invest 2002 Apr;25(4):362-8 | |
| NP05367 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | NA | Somastostatin | Somatostatin-28 | 6109284#Esch F, Böhlen P, Ling N, Benoit R, Brazeau P, Guillemin R#Primary structure of ovine hypothalamic somatostatin-28 and somatostatin-25#Proc Natl Acad Sci U S A 1980 Nov;77(11):6827-31 | |
| NP05368 |
SVDSTNNLPPRERKAGCKNFYWXGFTSC
|
28 | NA | Somastostatin | Somatostatin-28 | 2863928#Spiess J, Noe BD#Anglerfish pancreatic islets produce two forms of somatostatin-28#Adv Exp Med Biol 1985;188:141-54 | |
| NP05369 |
SVDNLPPRERKAGCKNFYWKGFTSC
|
25 | Oncorhynchus kisutch | Somastostatin | Somatostatin-25 | 2877919#Plisetskaya EM, Pollock HG, Rouse JB, Hamilton JW, Kimmel JR, Andrews PC, Gorbman A#Characterization of coho salmon (Oncorhynchus kisutch) islet somatostatins#Gen Comp Endocrinol 1986 Aug;63(2):252-63 Erratum in: Gen Comp Endocrinol 1987 Jan;65(1):166 | |
| NP05370 |
ALRAAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC
|
37 | Petromyzon marinus | Somastostatin | Somatostatin | 2902094#Andrews PC, Pollock HG, Elliott WM, Youson JH, Plisetskaya EM#Isolation and characterization of a variant somatostatin-14 and two related somatostatins of 34 and 37 residues from lamprey (Petromyzon marinus)#J Biol Chem 1988 Oct 25;263(30):15809-14 | |
| NP05371 |
FWKTFTSC
|
8 | Coturnix coturnix japonica | Somastostatin | Somatostatin 14 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05372 |
KNFFWKTFTSC
|
11 | Coturnix coturnix japonica | Somastostatin | Somatostatin 14 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05373 |
ANSNPALAPRE
|
11 | Coturnix coturnix japonica | Somastostatin | Somatostatin-28 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05374 |
SANSNPALAPR
|
11 | Coturnix coturnix japonica | Somastostatin | Somatostatin-28 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05375 |
SANSNPALAPRE
|
12 | Coturnix coturnix japonica | Somastostatin | Somatostatin-28 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05376 |
AGCKNFFWKTFTSC
|
14 | Oryzias latipes | Somastostatin | Somatostatin-1 | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05377 |
AGCRNFFWKTFTSC
|
14 | Oryzias latipes | Somastostatin | Somatostatin-2 | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05378 |
SANSNPAMAPRE
|
12 | Rattus norvegicus | Somastostatin | Somatostatin-28 (1-12) | 23410195#Karlsson O, Kultima K, Wadensten H, Nilsson A, Roman E, Andrén PE, Brittebo EB#Neurotoxin-induced neuropeptide perturbations in striatum of neonatal rats#J Proteome Res 2013 Apr 5;12(4):1678-90 | |
| NP05379 |
SANPALAPRERKAGCKNFFWKTFTSC
|
26 | Amia calva | Somastostatin | Somatostatin-26 | 8105513#Wang Y, Youson JH, Conlon JM#Prosomatostatin-I is processed to somatostatin-26 and somatostatin-14 in the pancreas of the bowfin, Amia calva#Regul Pept 1993 Aug 13;47(1):33-9 | |
| NP05380 |
AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC
|
35 | Lampetra fluviatilis | Somastostatin | Somatostatin-35 | 8575665#Conlon JM, Bondareva V, Rusakov Y, Plisetskaya EM, Mynarcik DC, Whittaker J#Characterization of insulin, glucagon, and somatostatin from the river lamprey, Lampetra fluviatilis#Gen Comp Endocrinol 1995 Oct;100(1):96-105 | |
| NP05381 |
AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC
|
34 | Myxine glutinosa | Somastostatin | Somatostatin-34 | 2896118#Conlon JM, Askensten U, Falkmer S, Thim L#Primary structures of somatostatins from the islet organ of the hagfish suggest an anomalous pathway of posttranslational processing of prosomatostatin-1#Endocrinology 1988 May;122(5):1855-9 | |
| NP05382 |
AGCKNFFWKTFTSC
|
14 | Oncorhynchus kisutch | Somastostatin | Somatostatin-14 | 2877919#Plisetskaya EM, Pollock HG, Rouse JB, Hamilton JW, Kimmel JR, Andrews PC, Gorbman A#Characterization of coho salmon (Oncorhynchus kisutch) islet somatostatins#Gen Comp Endocrinol 1986 Aug;63(2):252-63 Erratum in: Gen Comp Endocrinol 1987 Jan;65(1):166 | |
| NP05383 |
AGCKNFFWKTFSSC
|
14 | Petromyzon marinus | Somastostatin | Somatostatin-14 | 2902094#Andrews PC, Pollock HG, Elliott WM, Youson JH, Plisetskaya EM#Isolation and characterization of a variant somatostatin-14 and two related somatostatins of 34 and 37 residues from lamprey (Petromyzon marinus)#J Biol Chem 1988 Oct 25;263(30):15809-14 | |
| NP05384 |
AGCKNFFWKTFTSC
|
14 | Amia calva | Somastostatin | Somatostatin-14 | 8105513#Wang Y., Youson J.H., Conlon J.M.#Prosomatostatin-I is processed to somatostatin-26 and somatostatin-14 in the pancreas of the bowfin, Amia calva.# Regul. Pept. 47:33-39(1993). | |
| NP05385 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Canis familiaris | Somastostatin | Somatostatin-28 | ||
| NP05386 |
AGCKNFFWKTFTSC
|
14 | Canis familiaris | Somastostatin | Somatostatin-14 | ||
| NP05387 |
AAGPMLAPRERKAGCKNFFWKTFTSC
|
26 | Carassius auratus | Somastostatin | Somatostatin-26 (Potential) | ||
| NP05388 |
AGCKNFFWKTFTSC
|
14 | Carassius auratus | Somastostatin | Somatostatin-14 | ||
| NP05389 |
SANSNPALAPRERKAGCKNFFWKTFTSC
|
28 | Gallus gallus | Somastostatin | Somatostatin-28 | ||
| NP05390 |
AGCKNFFWKTFTSC
|
14 | Gallus gallus | Somastostatin | Somatostatin-14 | ||
| NP05391 |
AGCKNFFWKTFTSC
|
14 | Ictalurus punctatus | Somastostatin | Somatostatin-14 | 6114953#Andrews P.C., Dixon J.E.#Isolation and structure of a peptide hormone predicted from a mRNA sequence. A second somatostatin from the catfish pancreas.# J. Biol. Chem. 256:8267-8270(1981). | |
| NP05392 |
AGCKNFFWKTFTSC
|
14 | Lophius americanus | Somastostatin | Somatostatin-14 | 387385#Noe B.D., Spiess J., Rivier J.E., Vale W.#Isolation and characterization of somatostatin from anglerfish pancreatic islet.# Endocrinology 105:1410-1415(1979). | |
| NP05393 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Macaca fascicularis | Somastostatin | Somatostatin-28 | ||
| NP05394 |
AGCKNFFWKTFTSC
|
14 | Macaca fascicularis | Somastostatin | Somatostatin-14 | ||
| NP05395 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Ovis aries | Somastostatin | Somatostatin-28 | ||
| NP05396 |
AGCKNFFWKTFTSC
|
14 | Ovis aries | Somastostatin | Somatostatin-14 | ||
| NP05397 |
AGCKNFFWKTFTSC
|
14 | Pelophylax ridibundus | Somastostatin | Somatostatin-14 | 1358069#Vaudry H., Chartrel N., Conlon J.M.#Isolation of [Pro2,Met13]somatostatin-14 and somatostatin-14 from the frog brain reveals the existence of a somatostatin gene family in a tetrapod.# Biochem. Biophys. Res. Commun. 188:477-482(1992). | |
| NP05398 |
SANSSPLAARERKAGCKNFFWKTFTSC
|
27 | Protopterus annectens | Somastostatin | Somatostatin-27 (Potential) | ||
| NP05399 |
AGCKNFFWKTFTSC
|
14 | Protopterus annectens | Somastostatin | Somatostatin-14 | ||
| NP05400 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Sus scrofa | Somastostatin | Somatostatin-28 | 7353633#Pradayrol L., Joernvall H., Mutt V., Ribet A.#N-terminally extended somatostatin: the primary structure of somatostatin-28.#FEBS Lett. 109:55-58(1980).$6107906#Schally A.V., Huang W.-Y., Chang R.C.C., Arimura A., Redding T.W., Millar R.P., Hunkapiller M.W., Hood L.E.#Isolation and structure of pro-somatostatin: a putative somatostatin precursor from pig hypothalamus.#Proc. Natl. Acad. Sci. U.S.A. 77:4489-4493(1980). | |
| NP05401 |
AGCKNFFWKTFTSC
|
14 | Sus scrofa | Somastostatin | Somatostatin-14 | 1252409#Schally A.V., Dupont A., Arimura A., Redding T.W., Nishi N., Linthicum G.L., Schlesinger D.H.#Isolation and structure of somatostatin from porcine hypothalami.#Biochemistry 15:509-514(1976). | |
| NP05402 |
AGCKNFFWKTFTSC
|
14 | Bos taurus | Somastostatin | Somatostatin-14 | ||
| NP05403 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Bos taurus | Somastostatin | Somatostatin-28 | ||
| NP05404 |
DRMPCRNFFWKTFSSCK
|
17 | Homo sapiens | Somastostatin | Cortistatin-17 | ||
| NP05405 |
QEGAPPQQSARRDRMPCRNFFWKTFSSCK
|
29 | Homo sapiens | Somastostatin | Cortistatin-29 (Potential) | ||
| NP05406 |
AGCKNFFWKTFTSC
|
14 | Homo sapiens | Somastostatin | Somatostatin-14 | ||
| NP05407 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Homo sapiens | Somastostatin | Somatostatin-28 | ||
| NP05408 |
PCKNFFWKTFSSCK
|
14 | Mus musculus | Somastostatin | Cortistatin-14 | ||
| NP05409 |
APSDPRLRQF
|
10 | Mus musculus | Somastostatin | Antrin | ||
| NP05410 |
AGCKNFFWKTFTSC
|
14 | Mus musculus | Somastostatin | Somatostatin-14 | ||
| NP05411 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Mus musculus | Somastostatin | Somatostatin-28 | ||
| NP05412 |
PCKNFFWKTFSSCK
|
14 | Rattus norvegicus | Somastostatin | Cortistatin-14 | ||
| NP05413 |
QERPPLQQPPHRDKKPCKNFFWKTFSSCK
|
29 | Rattus norvegicus | Somastostatin | Cortistatin-29 (Potential) | ||
| NP05414 |
APSDPRLRQF
|
10 | Rattus norvegicus | Somastostatin | Antrin | 2891188# Benoit R., Ling N., Esch F.; # "A new prosomatostatin-derived peptide reveals a pattern for prohormone cleavage at monobasic sites."; # Science 238:1126-1129(1987). | |
| NP05415 |
AGCKNFFWKTFTSC
|
14 | Rattus norvegicus | Somastostatin | Somatostatin-14 | ||
| NP05416 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | Rattus norvegicus | Somastostatin | Somatostatin-28 |