Total number of results for Neuromedins are 15
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP03727 |
EFLFRPRN
|
8 | Canis familiaris | Neuromedins | Neuromedin U-8 | 10959581#Sakura N, Kurosawa K, Hashimoto T#Structure-activity relationships of neuromedin U#IV Absolute requirement of the arginine residue at position 7 of dog neuromedin U-8 for contractile activity Chem Pharm Bull (Tokyo) 2000 Aug;48(8):1166-70 | |
NP03728 |
EXLXRPRN
|
8 | Canis familiaris | Neuromedins | Neuromedin U-8 | 8904815#Kurosawa K, Sakura N, Hashimoto T#Structure-activity relationships of neuromedin U#III Contribution of two phenylalanine residues in dog neuromedin U-8 to the contractile activity Chem Pharm Bull (Tokyo) 1996 Oct;44(10):1880-4 | |
NP03729 |
YFLFRPRN
|
8 | Gallus gallus | Neuromedins | neuromedin U-8 | 1804545#Hashimoto T, Masui H, Uchida Y, Sakura N, Okimura K#Agonistic and antagonistic activities of neuromedin U-8 analogs substituted with glycine or D-amino acid on contractile activity of chicken crop smooth muscle preparations#Chem Pharm Bull (Tokyo) 1991 Sep;39(9):2319-22 | |
NP03730 |
GYFLFRPRN
|
9 | Sus scrofa | Neuromedins | Neuromedin U | 2381877#Murphy R, Turner CA, Furness JB, Parker L, Giraud A#Isolation and microsequence analysis of a novel form of neuromedin U from guinea pig small intestine#Peptides 1990 May-Jun;11(3):613-7 | |
NP03731 |
FWRRDSRATAADFTKKDYTATLGRPFFLFRPRN
|
33 | Bos taurus | Neuromedins | Neuromedin-S | ||
NP03732 |
ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN
|
33 | Homo sapiens | Neuromedins | Neuromedin-S | ||
NP03733 |
FRVDEEFQSPFASQSRGYFLFRPRN
|
25 | Homo sapiens | Neuromedins | Neuromedin-U-25 | ||
NP03734 |
LPRLLRLDSRMATVDFPKKDPTTSLGRPFFLFRPRN
|
36 | Mus musculus | Neuromedins | Neuromedin-S | ||
NP03735 |
FKAEYQSPSVGQSKGYFLFRPRN
|
23 | Mus musculus | Neuromedins | Neuromedin-U-23 | ||
NP03736 |
LPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRN
|
36 | Rattus norvegicus | Neuromedins | Neuromedin-S | 15635449#Mori K., Miyazato M., Ida T., Murakami N., Serino R., Ueta Y., Kojima M., Kangawa K.; #Identification of neuromedin S and its possible role in the mammalian circadian oscillator system.; #EMBO J. 24:325-335(2005). | |
NP03737 |
YKVNEYQGPVAPSGGFFLFRPRN
|
23 | Rattus norvegicus | Neuromedins | Neuromedin-U-23 | 3178840# Minamino N., Kangawa K., Honzawa M., Matsuo H.; #Isolation and structural determination of rat neuromedin U.; # Biochem. Biophys. Res. Commun. 156:355-360(1988).$3411332#Conlon J.M., Domin J., Thim L., Dimarzo V., Morris H.R., Bloom S.R.; #Primary structure of neuromedin U from the rat.; #J. Neurochem. 51:988-991(1988). | |
NP03738 |
FRLDEEFQGPIASQVRRQFLFRPRN
|
25 | Canis familiaris | Neuromedins | Neuromedin-U-25 | 2052487#O'Harte F, Bockman CS, Abel PW, Conlon JM#Isolation, structural characterization and pharmacological activity of dog neuromedin U#Peptides 1991 Jan-Feb;12(1):11-5 | |
NP03739 |
SDEEVQVPGGVISNGYFLFRPRN
|
23 | Litoria caerulea | Neuromedins | Neuromedin-U-23 | 10671478#Salmon AL, Johnsen AH, Bienert M, McMurray G, Nandha KA, Bloom SR, Shaw C#Isolation, structural characterization, and bioactivity of a novel neuromedin U analog from the defensive skin secretion of the Australasian tree frog, Litoria caerulea#J Biol Chem 2000 Feb 18;275(7):4549-54 | |
NP03740 |
DSSGIVGRPFFLFRPRN
|
17 | Bombina maxima | Neuromedins | Neuromedin-S-17 | 15927697#Lee W.H., Liu S.B., Shen J.H., Jin Y., Lai R., Zhang Y.#Identification and molecular cloning of a novel neuromedin U analog from the skin secretions of toad Bombina maxima.# Regul. Pept. 129:43-47(2005).$16682011#Chen T., Zhou M., Walker B., Harriot P., Mori K., Miyazato M.,Kangawa K., Shaw C.#Structural and functional analogs of the novel mammalian neuropeptide, neuromedin S (NmS), in the dermal venoms of Eurasian bombinid toads.#Biochem. Biophys. Res. Commun. 345:377-384(2006). | |
NP03741 |
DSSGIVGRPFFLFRPRN
|
17 | Bombina orientalis | Neuromedins | Neuromedin-S-17 | 16682011#Chen T., Zhou M., Walker B., Harriot P., Mori K., Miyazato M.,Kangawa K., Shaw C.#Structural and functional analogs of the novel mammalian neuropeptide, neuromedin S (NmS), in the dermal venoms of Eurasian bombinid toads.#Biochem. Biophys. Res. Commun. 345:377-384(2006). |