Total number of results for Molluscan ELH are 43
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02941 |
SSGVSLLTSNKDEEQRELLKAISNLLD
|
27 | Aplysia californica | Molluscan ELH | Acidic peptide | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02942 |
SSGVSLLTSNKDEEQRELLKA
|
21 | Aplysia californica | Molluscan ELH | Acidic peptide(1-20) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02943 |
LTSNKDEEQRELLKAISNLLD
|
21 | Aplysia californica | Molluscan ELH | Acidic peptide(7-27) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02944 |
TSNKDEEQRELLKAISNLLD
|
20 | Aplysia californica | Molluscan ELH | Acidic peptide(8-27) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02945 |
SNKDEEQRELLKA
|
13 | Aplysia californica | Molluscan ELH | Acidic peptide(9-20) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02946 |
SNKDEEQRELLKAISNLL
|
18 | Aplysia californica | Molluscan ELH | Acidic peptide(9-26) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02947 |
SNKDEEQRELLKAISNLLD
|
19 | Aplysia californica | Molluscan ELH | Acidic peptide(9-27) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02948 |
APRLRFYSL
|
9 | Aplysia californica | Molluscan ELH | Alpha-bag cell peptide | 16593372#Rothman B.S., Mayeri E., Brown R.O., Yuan P.-M., Shively J.E.; #Primary structure and neuronal effects of alpha-bag cell peptide, a second candidate neurotransmitter encoded by a single gene in bag cell neurons of Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 80:5753-5757(1983). | |
| NP02949 |
APRLRFY
|
7 | Aplysia californica | Molluscan ELH | Alpha-bag cell peptide(1-7) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02950 |
APRLRFYS
|
8 | Aplysia californica | Molluscan ELH | Alpha-bag cell peptide(1-8) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02951 |
RLRFH
|
5 | Aplysia californica | Molluscan ELH | Beta-bag cell peptide | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02952 |
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
|
39 | Aplysia californica | Molluscan ELH | Delta-bag cell peptide | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02953 |
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQ
|
36 | Aplysia californica | Molluscan ELH | Delta-bag cell peptide(1-36) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02954 |
ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK
|
36 | Aplysia californica | Molluscan ELH | Egg-laying hormone | 293751#Chiu A.Y., Hunkapiller M.W., Heller E., Stuart D.K., Hood L.E., Strumwasser F.; #Purification and primary structure of the neuropeptide egg-laying hormone of Aplysia californica.; #Proc. Natl. Acad. Sci. U.S.A. 76:6656-6660(1979). | |
| NP02955 |
ISINQDLKAITDML
|
14 | Aplysia californica | Molluscan ELH | Egg-laying hormone(1-14) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02956 |
ISINQDLKAITDMLLTEQIRERQRYLADL
|
29 | Aplysia californica | Molluscan ELH | Egg-laying hormone(1-29) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02957 |
LTEQIRERQRYLADLRQRLLEK
|
22 | Aplysia californica | Molluscan ELH | Egg-laying hormone(15-36) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02958 |
RQRLLEK
|
7 | Aplysia californica | Molluscan ELH | Egg-laying hormone(30-36) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02959 |
SVLTPSLSSLGESLESGIS
|
19 | Aplysia californica | Molluscan ELH | Epsilon-bag cell peptide | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02960 |
TPSLSSLGESLESGIS
|
16 | Aplysia californica | Molluscan ELH | Epsilon-bag cell peptide(4-19) | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02961 |
RLRFD
|
5 | Aplysia californica | Molluscan ELH | Gamma-bag cell peptide | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02962 |
RLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
|
46 | Aplysia californica | Molluscan ELH | Gamma-delta-bag cell peptide | 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998). | |
| NP02963 |
AVKLSSDGNYPFDLSKEDGAQPYFMTPRLRFYPI
|
34 | Aplysia californica | Molluscan ELH | Atrial gland peptide A | 6929554#Heller E., Kaczmarek L.K., Hunkapiller M.W., Hood L.E., Strumwasser F.; #Purification and primary structure of two neuroactive peptides that cause bag cell afterdischarge and egg-laying in Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 77:2328-2332(1980). | |
| NP02964 |
ISINQDLKAITDMLLTEQIQARRRCLDALRQRLLDLGKRDSDVSLFNGDLLPNGRCS
|
57 | Aplysia californica | Molluscan ELH | Califin-A | 3753705#Rothman B.S., Hawke D.H., Brown R.O., Lee T.D., Dehghan A.A., Shively J.E., Mayeri E.; #Isolation and primary structure of the califins,three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica.; #J. Biol. Chem. 261:1616-1623(1986). | |
| NP02965 |
ISINQDLKAITDMLLTEQIQARRRCLDALRQRLLDL
|
36 | Aplysia californica | Molluscan ELH | Califin-A large subunit | ||
| NP02966 |
DSDVSLFNGDLLPNGRCS
|
18 | Aplysia californica | Molluscan ELH | Califin-A small subunit | 3379066#Nagle G.T., Painter S.D., Blankenship J.E., Kurosky A.; #Proteolytic processing of egg-laying hormone-related precursors in Aplysia. Identification of peptide regions critical for biological activity.; #J. Biol. Chem. 263:9223-9237(1988). | |
| NP02967 |
ISINQDLKAITDMLLTEQIQARQRCLAALRQRLLDL
|
36 | Aplysia californica | Molluscan ELH | Califin-B large subunit | 3753705#Rothman B.S., Hawke D.H., Brown R.O., Lee T.D., Dehghan A.A., Shively J.E., Mayeri E.; #Isolation and primary structure of the califins, three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica.; #J. Biol. Chem. 261:1616-1623(1986). | |
| NP02968 |
ISINQDLKAITDMLLTEQIQARRRCLAALRQRLLDL
|
36 | Aplysia californica | Molluscan ELH | Califin-C large subunit | 3753705#Rothman B.S., Hawke D.H., Brown R.O., Lee T.D., Dehghan A.A., Shively J.E., Mayeri E.; #Isolation and primary structure of the califins, three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica.; #J. Biol. Chem. 261:1616-1623(1986). | |
| NP02969 |
AVKSSSYEKYPFDLSKEDGAQPYFMTPRLRFYPI
|
34 | Aplysia californica | Molluscan ELH | Atrial gland peptide B | 6929554#Heller E., Kaczmarek L.K., Hunkapiller M.W., Hood L.E., Strumwasser F.; #Purification and primary structure of two neuroactive peptides that cause bag cell afterdischarge and egg-laying in Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 77:2328-2332(1980). | |
| NP02970 |
ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK
|
36 | Aplysia fasciata | Molluscan ELH | Egg-laying hormone | 3226961#Nagle G.T., Painter S.D., Blankenship J.E., Choate J.V.A., Kurosky A.; #The bag cell egg-laying hormones of Aplysia brasiliana and Aplysia californica are identical.; #Peptides 9:867-872(1988). | |
| NP02971 |
SSEVALAASDKGDEERELLNTLSNLLE
|
27 | Aplysia parvula | Molluscan ELH | Acidic peptide | ||
| NP02972 |
APRLRFYSL
|
9 | Aplysia parvula | Molluscan ELH | Alpha-bag cell peptide | ||
| NP02973 |
RLRFH
|
5 | Aplysia parvula | Molluscan ELH | Beta-bag cell peptide | ||
| NP02974 |
ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK
|
36 | Aplysia parvula | Molluscan ELH | Egg-laying hormone | ||
| NP02975 |
RIRFN
|
5 | Aplysia parvula | Molluscan ELH | Gamma-bag cell peptide | ||
| NP02976 |
RIRFH
|
5 | Aplysia parvula | Molluscan ELH | Gamma-bag cell peptide | ||
| NP02977 |
EPRLRFHDV
|
9 | Lymnaea stagnalis | Molluscan ELH | Alpha-CDCP | ||
| NP02978 |
RLRFH
|
5 | Lymnaea stagnalis | Molluscan ELH | Beta-1-CDCP | ||
| NP02979 |
RLRAS
|
5 | Lymnaea stagnalis | Molluscan ELH | Beta-2-CDCP | ||
| NP02980 |
RLRFN
|
5 | Lymnaea stagnalis | Molluscan ELH | Beta-3-CDCP | ||
| NP02981 |
RVDSADESNDDGFD
|
14 | Lymnaea stagnalis | Molluscan ELH | Calfluxin | ||
| NP02982 |
LSITNDLRAIADSYLYDQHKLRERQEENLRRRFLEL
|
36 | Lymnaea stagnalis | Molluscan ELH | Ovulation hormone | 16578788#Ebberink R.H.M., van Loenhout H., Geraerts W.P.M., Joosse J.; #Purification and amino acid sequence of the ovulation neurohormone of Lymnaea stagnalis.; #Proc. Natl. Acad. Sci. U.S.A. 82:7767-7771(1985). | |
| NP02983 |
SATAEEGSENAEIEESHLGNSRS
|
23 | Lymnaea stagnalis | Molluscan ELH | X-CDCP |