Total number of results for Calcitonin-like peptide are 6
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00859 |
GLDLGLGRGFSGSQAAKHLMGLAAANFAGGP
|
31 | Homarus americanus | Calcitonin-like peptide | Calcitonin-like diuretic hormone | 20008368#Christie AE, Stevens JS, Bowers MR, Chapline MC, Jensen DA, Schegg KM, Goldwaser J, Kwiatkowski MA, Pleasant TK Jr, Shoenfeld L, Tempest LK, Williams CR, Wiwatpanit T, Smith CM, Beale KM, Towle DW, Schooley DA, Dickinson PS#Identification of a calcitonin-like diuretic hormone that functions as an intrinsic modulator of the American lobster, Homarus americanus, cardiac neuromuscular system#J Exp Biol 2010 Jan 1;213(1):118-27 | |
NP00860 |
TVDFGLSRGYSGAQEAKHRMAMAVANFAGGP
|
31 | Aedes aegypti | Calcitonin-like peptide | Diuretic hormone 31 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00861 |
GVDFGLGRGYSGSQAAKHLMGLAAANYAIGP
|
31 | Daphnia pulex | Calcitonin-like peptide | Diuretic hormone-31 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00862 |
AGGLLDFGLSRGASGAEAAKARLGLKLANDPYGP
|
34 | Ixodes scapularis | Calcitonin-like peptide | Diuretic hormone-35 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
NP00863 |
GLDLGLNRGFSGSQAAKHLMGLAAANYAGGP
|
31 | Nasonia vitripennis | Calcitonin-like peptide | Diuretic hormone 31 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP00864 |
GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
|
31 | Apis mellifera | Calcitonin-like peptide | Calcitonin-like diuretic hormone | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). |