Browse by family
Total number of results for Calcitonin-like peptide are 6
Download as  Fasta  All
NPID Sequence Length Organism Family Name PMID Peptide_REF
NP00859
GLDLGLGRGFSGSQAAKHLMGLAAANFAGGP
31 Homarus americanus Calcitonin-like peptide Calcitonin-like diuretic hormone 20008368#Christie AE, Stevens JS, Bowers MR, Chapline MC, Jensen DA, Schegg KM, Goldwaser J, Kwiatkowski MA, Pleasant TK Jr, Shoenfeld L, Tempest LK, Williams CR, Wiwatpanit T, Smith CM, Beale KM, Towle DW, Schooley DA, Dickinson PS#Identification of a calcitonin-like diuretic hormone that functions as an intrinsic modulator of the American lobster, Homarus americanus, cardiac neuromuscular system#J Exp Biol 2010 Jan 1;213(1):118-27
NP00860
TVDFGLSRGYSGAQEAKHRMAMAVANFAGGP
31 Aedes aegypti Calcitonin-like peptide Diuretic hormone 31 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00861
GVDFGLGRGYSGSQAAKHLMGLAAANYAIGP
31 Daphnia pulex Calcitonin-like peptide Diuretic hormone-31 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00862
AGGLLDFGLSRGASGAEAAKARLGLKLANDPYGP
34 Ixodes scapularis Calcitonin-like peptide Diuretic hormone-35 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5
NP00863
GLDLGLNRGFSGSQAAKHLMGLAAANYAGGP
31 Nasonia vitripennis Calcitonin-like peptide Diuretic hormone 31 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310
NP00864
GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
31 Apis mellifera Calcitonin-like peptide Calcitonin-like diuretic hormone 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).