| BPID | Classification | Organism | Name | Length | Sequence |
|---|---|---|---|---|---|
| BP0387 | Toxin and venom peptide | Tityus serrulatus | Toxin Ts16 | 29 | GCMKEYCAGQCRGKVSQDYCLKHCKCIPR
|
| BP0399 | Toxin and venom peptide | Tityus serrulatus | Potassium channel toxin alpha-KTx 4.1 | 37 | VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP
|
| BP0400 | Toxin and venom peptide | Tityus serrulatus | Potassium channel toxin alpha-KTx 4.2 | 35 | VVIGQRCYRSPDCYSACKKLVGKATGKCTNGRCDC
|
| BP0555 | Toxin and venom peptide | Tityus serrulatus | Peptide TsPep1 | 29 | KPKCGLCRYRCCSGGCSSGKCVNGACDCS |
| BP0669 | Toxin and venom peptide | Tityus serrulatus | Beta-mammal/insect toxin Ts1 | 61 | KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
|
| BP1037 | Toxin and venom peptide | Tityus serrulatus | Potassium channel toxin alpha-KTx 12.1 | 40 | WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT
|
| BP1242 | Toxin and venom peptide | Tityus serrulatus | Alpha-mammal toxin Ts3 | 64 | KKDGYPVEYDNCAYICWNYDNAYCDKLCKDKKADSGYCYWVHILCYCYGLPDSEPTKTNGKCKS
|