Browse page

Total number of results for Haplopelma hainanum are 4

BPID	Classification	Organism	Name	Length	Sequence
BP0374	Toxin and venom peptide	Haplopelma hainanum	Mu-theraphotoxin-Hhn2b	33	ECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL
BP0375	Toxin and venom peptide	Haplopelma hainanum	Mu-theraphotoxin-Hhn2a	33	GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL
BP0686	Toxin and venom peptide	Haplopelma hainanum	Mu-theraphotoxin-Hhn2b	33	ECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL
BP0718	Toxin and venom peptide	Haplopelma hainanum	Mu-theraphotoxin-Hhn1b	35	ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI