Browse by organism
Total number of results for Bos taurus are 192
Download as  Fasta  All
NPID Sequence Length Organism Family Name PMID Peptide_REF
NP00021
MSLQADFDKAAKDVRKLKTRPDDEELKELYGLYKQSVIGDIDIECPALLDLKGKAKWEAWNLQKGLSKEDAMNAYISKAKELIEKYGI
88 Bos taurus ACBP Acyl-CoA-binding domain-containing protein 7
NP00022
MCQVEFEMACAAIKQLKGPVSDQEKLLVYSYYKQATQGDCNIPAPPATDLKAKAKWEAWNENKGMSKMDAMRIYIAKVEELKKNEAG
87 Bos taurus ACBP Diazepam-binding inhibitor-like 5
NP00033
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
86 Bos taurus ACBP Acyl-CoA-binding protein 3525533# Marquardt H., Todaro G.J., Shoyab M.; # "Complete amino acid sequences of bovine and human endozepines. Homology with rat diazepam binding inhibitor."; # J. Biol. Chem. 261:9727-9731(1986).$3663196#Mikkelsen J., Hoejrup P., Nielsen P.F., Roepstorff P., Knudsen J.; #"Amino acid sequence of acyl-CoA-binding protein from cow liver."; #Biochem. J. 245:857-861(1987).$1622397#Jensen M.S., Hoejrup P., Rasmussen J.T., Knudsen J.; #"Purification and characterization of variants of acyl-CoA-binding protein in the bovine liver."; #Biochem. J. 284:809-812(1992).
NP00039
YRQSLNNFQGLRSFGCRFGTCTVQKLAHQIYHFTDKDKDGSAPRSKISPQGY
52 Bos taurus Adrenomedullin Adrenomedullin
NP00040
LRSFGCRFGTCTVQKL
16 Bos taurus Adrenomedullin Adrenomedullin-11-26
NP00041
ARLDVAAEFRKKWNKWALSR
20 Bos taurus Adrenomedullin Proadrenomedullin N-20 terminal peptide
NP00597
QRPRLSHKGPMPF
13 Bos taurus Apelin Apelin-13
NP00598
SGPGPWQGGRRKFRRQRPRLSHKGPMPF
28 Bos taurus Apelin Apelin-28
NP00599
GPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF
31 Bos taurus Apelin Apelin-31
NP00600
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF
36 Bos taurus Apelin Apelin-36
NP00786
APVTAGRGGALAKMYTRGNHWAVGHLM
27 Bos taurus Bombesin/neuromedin-B/ranatensin Gastrin-releasing peptide
NP00787
GNHWAVGHLM
10 Bos taurus Bombesin/neuromedin-B/ranatensin Neuromedin-C 2755876# Lemaire S., Trifaro J.-M., Chouinard L., Cecyre D., Dessureault J., Mercier P., Dumont M.; # "Structural identification, subcellular localization and secretion of bovine adrenomedullary neuromedin C [GRP-(18-27)]."; # Peptides 10:355-360(1989).
NP00788
GNLWATGHFM
10 Bos taurus Bombesin/neuromedin-B/ranatensin Neuromedin-B
NP00789
APLGWDLPESRSRASKIRVHPRGNLWATGHFM
32 Bos taurus Bombesin/neuromedin-B/ranatensin Neuromedin-B-32
NP00809
KRPPGFSPFR
10 Bos taurus Bradykinin Lysyl-bradykinin 4986212#Kato H., Nagasawa S., Suzuki T.#Studies on the structure of bovine kininogen: cleavages of disulfide bonds and of methionyl bonds in kininogen-II.#J. Biochem. 67:313-323(1970).
NP00810
RPPGFSPFR
9 Bos taurus Bradykinin Bradykinin 4986212#Kato H., Nagasawa S., Suzuki T.#Studies on the structure of bovine kininogen: cleavages of disulfide bonds and of methionyl bonds in kininogen-II.#J. Biochem. 67:313-323(1970).
NP00820
ACNTATCMTHRLAGWLSRSGSMVRSNLLPTKMGFKIFNGPRRNSWF
46 Bos taurus Calcitonin Calcitonin receptor-stimulating peptide 1
NP00844
CSNLSTCVLSAYWKDLNNYHRFSGMGFGPETP
32 Bos taurus Calcitonin Calcitonin 5259773# Brewer H.B. Jr., Ronan R.; # "Amino acid sequence of bovine thyrocalcitonin."; # Proc. Natl. Acad. Sci. U.S.A. 63:940-947(1969).
NP00845
CGTATCETQRLANFLAPSSNKLGAIFSPTKMGSNTY
36 Bos taurus Calcitonin Islet amyloid polypeptide
NP00867
QEDAELQPRALDIYSAVEDASHEKELIEALQEVLKKLKS
39 Bos taurus CART CART(1-39) (By similarity)
NP00868
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
48 Bos taurus CART CART(42-89) (By similarity)
NP00880
QEDAELQPRALDIYSAVEDASHEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
89 Bos taurus CART Cocaine- and amphetamine-regulated
NP00905
GSAKVAFSAIRSTNH
15 Bos taurus Cerebellins [des-Ser1]-cerebellin (Potential)
NP00906
SGSAKVAFSAIRSTNH
16 Bos taurus Cerebellins Cerebellin #Colgrave M.;#"Neuropeptidomics of the bovine hypothalamus.";# Submitted (JAN-2010) to UniProtKB.
NP00907
QNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL
172 Bos taurus Cerebellins Cerebellin-1
NP00908
QEGTEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGEIGNGTSGAIYFDQVLVNEGGGFDRTSGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVVSAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
173 Bos taurus Cerebellins Cerebellin-3
NP00945
FPKPAGSQDKPLHNRELSAERPLNEQIAEAEADEIKKTYPPENKPGESNYSFVDNLNLLKAITEKEKNEKERQSVKISPNDNKLNVEDVDSTKNRRLIDDYDSTKSGLDRKFQDDPDGLHQLDGTPLTAEDIVQKIATRIYEENDRGVFDRIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEELNKPTSKTESQTGKIPEKVTPMAAIQDAFTNGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNVTDNKSKLFAVPSEKSHEETDSTKEEAAKMEKEYGTLKDSTKDDDSNPRGKTDEHKGKTEAYLEAIRKNIDWLKKHNKKENKEDYDLSKMRDFINQQADAYVEKGILDKEEADAIKRIYSSL
449 Bos taurus Chromogranin/secretogranin Secretogranin-3
NP00969
RSMRLSFRARGYGFRGPGLQL
21 Bos taurus Chromogranin/secretogranin Catestatin 12795588# Lee J.C., Taylor C.V., Gaucher S.P., Toneff T., Taupenot L., Yasothornsrikul S., Mahata S.K., Sei C., Parmer R.J., Neveu J.M., Lane W.S., Gibson B.W., O'Connor D.T., Hook V.Y.H.; # "Primary sequence characterization of catestatin intermediates and peptides defines proteolytic cleavage sites utilized for converting chromogranin A into active catestatin secreted from neuroendocrine chromaffin cells."; # Biochemistry 42:6938-6946(2003).$9786174#Kennedy BP, Mahata SK, O'Connor DT, Ziegler MG#Mechanism of cardiovascular actions of the chromogranin A fragment catestatin in vivo#Peptides 1998;19(7):1241-8
NP00970
YPGPQAKEDSEGPSQGPASREK
22 Bos taurus Chromogranin/secretogranin Chromacin 8910482#Strub J.-M., Goumon Y., Lugardon K., Capon C., Lopez M., Moniatte M., van Dorsselaer A., Aunis D., Metz-Boutigue M.-H.; #"Antibacterial activity of glycosylated and phosphorylated chromogranin A-derived peptide 173-194 from bovine adrenal medullary chromaffin granules."; #J. Biol. Chem. 271:28533-28540(1996).
NP00971
LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEVTEEVSSKDAAEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNAHPLASLPSPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKAVPEEESPPTAAFKPPPSLGNKETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEEEMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKMDQLAKELTAEKRLEGEEEEEEDPDRSMRLSFRARGYGFRGPGLQLRRGWRPNSREDSVEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLEELRRG
431 Bos taurus Chromogranin/secretogranin Chromogranin-A
NP00972
SDEDSDGDRPQASPGLGPGP
20 Bos taurus Chromogranin/secretogranin Chromostatin 1996343#Galindo E., Rill A., Bader M.-F., Aunis D.; #"Chromostatin, a 20-amino acid peptide derived from chromogranin A, inhibits chromaffin cell secretion."; #Proc. Natl. Acad. Sci. U.S.A. 88:1426-1430(1991).
NP00973
AAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEEEMARAPQVLFRG
47 Bos taurus Chromogranin/secretogranin Pancreastatin 2756155#Nakano I., Funakoshi A., Miyasaka K., Ishida K., Makk G., Angwin P., Chang D., Tatemoto K.; #"Isolation and characterization of bovine pancreastatin."; #Regul. Pept. 25:207-213(1989).
NP00974
LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKELQDLALQGAKERTHQQ
76 Bos taurus Chromogranin/secretogranin Vasostatin-1 12795588# Lee J.C., Taylor C.V., Gaucher S.P., Toneff T., Taupenot L., Yasothornsrikul S., Mahata S.K., Sei C., Parmer R.J., Neveu J.M., Lane W.S., Gibson B.W., O'Connor D.T., Hook V.Y.H.; # "Primary sequence characterization of catestatin intermediates and peptides defines proteolytic cleavage sites utilized for converting chromogranin A into active catestatin secreted from neuroendocrine chromaffin cells."; # Biochemistry 42:6938-6946(2003).
NP00975
WSKMDQLAKELTAE
14 Bos taurus Chromogranin/secretogranin WE-14
NP00976
SAEFPDFYDSEEQMSPQHTAENEEEKAGQGVLTEEEEKELENLAAMDLELQKIAEKFSGTRRG
63 Bos taurus Chromogranin/secretogranin CCB peptide 15174145#Gasnier C., Lugardon K., Ruh O., Strub J.-M., Aunis D., Metz-Boutigue M.H.; #"Characterization and location of post-translational modifications on chromogranin B from bovine adrenal medullary chromaffin granules."; #Proteomics 4:1789-1801(2004).
NP00977
QYDRVAELDQLLHY
14 Bos taurus Chromogranin/secretogranin Peptide BAM-1745 1554736#Dillen L., Boel S., De Potter W.P., Claeys M.; #"Mass spectrometric characterization of bovine chromaffin granule peptides related to chromogranin B."; #Biochim. Biophys. Acta 1120:105-112(