Browse by organism
Total number of results for Aplysia californica are 150
Download as  Fasta  All
NPID Sequence Length Organism Family Name PMID Peptide_REF
NP01571
FLRF
4 Aplysia californica FMRFamide related peptide FLRF-amide
NP01572
FMRF
4 Aplysia californica FMRFamide related peptide FMRF-amide
NP02518
QNYHFSNGWYAG
12 Aplysia californica GnRH GnRH 18178211#Zhang L, Tello JA, Zhang W, Tsai PS#Molecular cloning, expression pattern, and immunocytochemical localization of a gonadotropin-releasing hormone-like molecule in the gastropod mollusk, Aplysia californica#Gen Comp Endocrinol 2008 Apr 1;156(2):201-9
NP02594
NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMVKRDTENVNDKLRGILLNKKEAFSYLTKREASGSITCECCFNQCRIFELAQYCRLPDHFFSRISRTGRSNSGHAQLEDNFS
125 Aplysia californica Insulin Insulin
NP02595
EASGSITCECCFNQCRIFELAQYCRLPDHFFSRIS
35 Aplysia californica Insulin Insulin A chain 10479677#Floyd P.D., Li L., Rubakhin S.S., Sweedler J.V., Horn C.C., Kupfermann I., Alexeeva V.Y., Ellis T.A., Dembrow N.C., Weiss K.R., Vilim F.S.; #Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.; #J. Neurosci. 19:7732-7741(1999).
NP02596
NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMV
45 Aplysia californica Insulin Insulin B chain 10479677#Floyd P.D., Li L., Rubakhin S.S., Sweedler J.V., Horn C.C., Kupfermann I., Alexeeva V.Y., Ellis T.A., Dembrow N.C., Weiss K.R., Vilim F.S.; #Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.; #J. Neurosci. 19:7732-7741(1999).
NP02597
NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLA
41 Aplysia californica Insulin Insulin B chain' 10479677#Floyd P.D., Li L., Rubakhin S.S., Sweedler J.V., Horn C.C., Kupfermann I., Alexeeva V.Y., Ellis T.A., Dembrow N.C., Weiss K.R., Vilim F.S.; #Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.; #J. Neurosci. 19:7732-7741(1999).
NP02941
SSGVSLLTSNKDEEQRELLKAISNLLD
27 Aplysia californica Molluscan ELH Acidic peptide 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02942
SSGVSLLTSNKDEEQRELLKA
21 Aplysia californica Molluscan ELH Acidic peptide(1-20) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02943
LTSNKDEEQRELLKAISNLLD
21 Aplysia californica Molluscan ELH Acidic peptide(7-27) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02944
TSNKDEEQRELLKAISNLLD
20 Aplysia californica Molluscan ELH Acidic peptide(8-27) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02945
SNKDEEQRELLKA
13 Aplysia californica Molluscan ELH Acidic peptide(9-20) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02946
SNKDEEQRELLKAISNLL
18 Aplysia californica Molluscan ELH Acidic peptide(9-26) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02947
SNKDEEQRELLKAISNLLD
19 Aplysia californica Molluscan ELH Acidic peptide(9-27) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02948
APRLRFYSL
9 Aplysia californica Molluscan ELH Alpha-bag cell peptide 16593372#Rothman B.S., Mayeri E., Brown R.O., Yuan P.-M., Shively J.E.; #Primary structure and neuronal effects of alpha-bag cell peptide, a second candidate neurotransmitter encoded by a single gene in bag cell neurons of Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 80:5753-5757(1983).
NP02949
APRLRFY
7 Aplysia californica Molluscan ELH Alpha-bag cell peptide(1-7) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02950
APRLRFYS
8 Aplysia californica Molluscan ELH Alpha-bag cell peptide(1-8) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02951
RLRFH
5 Aplysia californica Molluscan ELH Beta-bag cell peptide 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02952
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
39 Aplysia californica Molluscan ELH Delta-bag cell peptide 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02953
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQ
36 Aplysia californica Molluscan ELH Delta-bag cell peptide(1-36) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02954
ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK
36 Aplysia californica Molluscan ELH Egg-laying hormone 293751#Chiu A.Y., Hunkapiller M.W., Heller E., Stuart D.K., Hood L.E., Strumwasser F.; #Purification and primary structure of the neuropeptide egg-laying hormone of Aplysia californica.; #Proc. Natl. Acad. Sci. U.S.A. 76:6656-6660(1979).
NP02955
ISINQDLKAITDML
14 Aplysia californica Molluscan ELH Egg-laying hormone(1-14) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02956
ISINQDLKAITDMLLTEQIRERQRYLADL
29 Aplysia californica Molluscan ELH Egg-laying hormone(1-29) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02957
LTEQIRERQRYLADLRQRLLEK
22 Aplysia californica Molluscan ELH Egg-laying hormone(15-36) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02958
RQRLLEK
7 Aplysia californica Molluscan ELH Egg-laying hormone(30-36) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02959
SVLTPSLSSLGESLESGIS
19 Aplysia californica Molluscan ELH Epsilon-bag cell peptide 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02960
TPSLSSLGESLESGIS
16 Aplysia californica Molluscan ELH Epsilon-bag cell peptide(4-19) 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02961
RLRFD
5 Aplysia californica Molluscan ELH Gamma-bag cell peptide 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02962
RLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
46 Aplysia californica Molluscan ELH Gamma-delta-bag cell peptide 9520477#Garden R.W., Shippy S.A., Li L., Moroz T.P., Sweedler J.V.;#Proteolytic processing of the Aplysia egg-laying hormone prohormone.;#Proc. Natl. Acad. Sci. U.S.A. 95:3972-3977(1998).
NP02963
AVKLSSDGNYPFDLSKEDGAQPYFMTPRLRFYPI
34 Aplysia californica Molluscan ELH Atrial gland peptide A 6929554#Heller E., Kaczmarek L.K., Hunkapiller M.W., Hood L.E., Strumwasser F.; #Purification and primary structure of two neuroactive peptides that cause bag cell afterdischarge and egg-laying in Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 77:2328-2332(1980).
NP02964
ISINQDLKAITDMLLTEQIQARRRCLDALRQRLLDLGKRDSDVSLFNGDLLPNGRCS
57 Aplysia californica Molluscan ELH Califin-A 3753705#Rothman B.S., Hawke D.H., Brown R.O., Lee T.D., Dehghan A.A., Shively J.E., Mayeri E.; #Isolation and primary structure of the califins,three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica.; #J. Biol. Chem. 261:1616-1623(1986).
NP02965
ISINQDLKAITDMLLTEQIQARRRCLDALRQRLLDL
36 Aplysia californica Molluscan ELH Califin-A large subunit
NP02966
DSDVSLFNGDLLPNGRCS
18 Aplysia californica Molluscan ELH Califin-A small subunit 3379066#Nagle G.T., Painter S.D., Blankenship J.E., Kurosky A.; #Proteolytic processing of egg-laying hormone-related precursors in Aplysia. Identification of peptide regions critical for biological activity.; #J. Biol. Chem. 263:9223-9237(1988).
NP02967
ISINQDLKAITDMLLTEQIQARQRCLAALRQRLLDL
36 Aplysia californica Molluscan ELH Califin-B large subunit 3753705#Rothman B.S., Hawke D.H., Brown R.O., Lee T.D., Dehghan A.A., Shively J.E., Mayeri E.; #Isolation and primary structure of the califins, three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica.; #J. Biol. Chem. 261:1616-1623(1986).
NP02968
ISINQDLKAITDMLLTEQIQARRRCLAALRQRLLDL
36 Aplysia californica Molluscan ELH Califin-C large subunit 3753705#Rothman B.S., Hawke D.H., Brown R.O., Lee T.D., Dehghan A.A., Shively J.E., Mayeri E.; #Isolation and primary structure of the califins, three biologically active egg-laying hormone-like peptides from the atrial gland of Aplysia californica.; #J. Biol. Chem. 261:1616-1623(1986).
NP02969
AVKSSSYEKYPFDLSKEDGAQPYFMTPRLRFYPI
34 Aplysia californica Molluscan ELH Atrial gland peptide B 6929554#Heller E., Kaczmarek L.K., Hunkapiller M.W., Hood L.E., Strumwasser F.; #Purification and primary structure of two neuroactive peptides that cause bag cell afterdischarge and egg-laying in Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 77:2328-2332(1980).
NP03031
PMSMLRL
7 Aplysia californica Myomodulin Myomodulin-A 3474664#Cropper E.C., Tenenbaum R., Kolks M.A.G., Kupfermann I., Weiss K.R.; #Myomodulin: a bioactive neuropeptide present in an identified cholinergic buccal motor neuron of Aplysia.; #Proc. Natl. Acad. Sci. U.S.A. 84:5483-5486(1987).
NP03032
GSYRMMRL
8 Aplysia californica Myomodulin Myomodulin-B 1788132#Cropper E.C., Vilim F.S., Alevizos A., Tenenbaum R., Kolks M.A.G., Rosen S., Kupfermann I., Weiss K.R.; #Structure, bioactivity, and cellular localization of myomodulin B: a novel Aplysia peptide.; #Peptides 12:683-690(1991).
NP03033
GLSMLRL
7 Aplysia californica Myomodulin Myomodulin-D 7472354#Brezina V., Bank B., Cropper E.C., Rosen S., Vilim F.S., Kupfermann I., Weiss K.R.; #Nine members of the myomodulin family of peptide cotransmitters at the B16-ARC neuromuscular junction of Aplysia.; #J. Neurophysiol. 74:54-72(1995).
NP03034
SLNMSRL
7 Aplysia californica Myomodulin Myomodulin-F 7472354#Brezina V., Bank B., Cropper E.C., Rosen S., Vilim F.S., Kupfermann I., Weiss K.R.; #Nine members of the myomodulin family of peptide cotransmitters at the B16-ARC neuromuscular junction of Aplysia.; #J. Neurophysiol. 74:54-72(1995).
NP03035
TLSMLRL
7 Aplysia californica Myomodulin Myomodulin-G (Potential)
NP03036
GLHMLRL
7 Aplysia californica Myomodulin Myomodulin-H (Potential)
NP03037
SLSMLRL
7 Aplysia californica Myomodulin Myomodulin-I (Potential)
NP03038
GGSLDALRSGHQVPMLRA
18 Aplysia californica Myomodulin MMG2-DPa 16237168#Proekt A., Vilim F.S., Alexeeva V., Brezina V., Friedman A., Jing J., Li L., Zhurov Y., Sweedler J.V., Weiss K.R.;#Identification of a new neuropeptide precursor reveals a novel source of extrinsic modulation in the feeding system of Aplysia.;#J. Neurosci. 25:9637-9648(2005).
NP03039
QPPLPRY
7 Aplysia californica Myomodulin MMG2-DPb 16237168#Proekt A., Vilim F.S., Alexeeva V., Brezina V., Friedman A., Jing J., Li L., Zhurov Y., Sweedler J.V., Weiss K.R.;#Identification of a new neuropeptide precursor reveals a novel source of extrinsic modulation in the feeding system of Aplysia.;#J. Neurosci. 25:9637-9648(2005).
NP03040
AVALPRI
7 Aplysia californica Myomodulin MMG2-DPd 16237168#Proekt A., Vilim F.S., Alexeeva V., Brezina V., Friedman A., Jing J., Li L., Zhurov Y., Sweedler J.V., Weiss K.R.;#Identification of a new neuropeptide precursor reveals a novel source of extrinsic modulation in the feeding system of Aplysia.;#J. Neurosci. 25:9637-9648(2005).
NP03041
AVPRPRI
7 Aplysia californica Myomodulin MMG2-DPf 16237168#Proekt A., Vilim F.S., Alexeeva V., Brezina V., Friedman A., Jing J., Li L., Zhurov Y., Sweedler J.V., Weiss K.R.;#Identification of a new neuropeptide precursor reveals a novel source of extrinsic modulation in the feeding system of Aplysia.;#J. Neurosci. 25:9637-9648(2005).
NP03042
GWSMLRL
7 Aplysia californica Myomodulin Myomodulin-C 9809658#Li L., Moroz T.P., Garden R.W., Floyd P.D., Weiss K.R., Sweedler J.V.;#Mass spectrometric survey of interganglionically transported peptides in Aplysia.;#Peptides 19:1425-1433(1998).
NP03043
GLQMLRL
7 Aplysia californica Myomodulin Myomodulin-E 9809658#Li L., Moroz T.P., Garden R.W., Floyd P.D., Weiss K.R., Sweedler J.V.;#Mass spectrometric survey of interganglionically transported peptides in Aplysia.;#Peptides 19:1425-1433(1998).
NP03100
EVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
43 Aplysia californica NA histidine-rich basic peptide 2573895#Nagle GT, Knock SL, Painter SD, Blankenship JE, Fritz RR, Kurosky A#Aplysia californica neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and peptide I#Peptides 1989 Jul-Aug;10(4):849-57
NP03101
NWF
3 Aplysia californica NA NdWFamide 21388150#Bai L, Romanova EV, Sweedler JV#Distinguishing endogenous D-amino acid-containing neuropeptides in individual neurons using tandem mass spectrometry#Anal Chem 2011 Apr 1;83(7):2794-800
NP03195
ELNFQHAFV
9 Aplysia californica NA Enterin 11588196#Furukawa Y, Nakamaru K, Wakayama H, Fujisawa Y, Minakata H, Ohta S, Morishita F, Matsushima O, Li L, Romanova E, Sweedler JV, Park JH, Romero A, Cropper EC, Dembrow NC, Jing J, Weiss KR, Vilim FS#The enterins: a novel family of neuropeptides isolated from the enteric nervous system and CNS of Aplysia#J Neurosci 2001 Oct 15;21(20):8247-61
NP03423
QVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
43 Aplysia californica NA Histidine-rich basic peptide 2573895#Nagle G.T., Knock S.L., Painter S.D., Blankenship J.E., Fritz R.R., Kurosky A.; #Aplysia californica neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and peptide I.; #Peptides 10:849-857(1989).
NP03424
EEVFDDTDVGDELTNALESVLTDFKD
26 Aplysia californica NA Peptide I 2573895#Nagle G.T., Knock S.L., Painter S.D., Blankenship J.E., Fritz R.R., Kurosky A.; #Aplysia californica neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and peptide I.; #Peptides 10:849-857(1989).
NP03425
EAEEPSAFMTRL
12 Aplysia californica NA Peptide II
NP03426
APSWRPQGRF
10 Aplysia californica NA Luqin 7784264#Aloyz R.S., DesGroseillers L.; #Processing of the L5-67 precursor peptide and characterization of LUQIN in the LUQ neurons of Aplysia californica.; #Peptides 16:331-338(1995).
NP03427
TIPDRLPQTEESSLPDFGFSHLPALPLEL
29 Aplysia californica NA Luqin-B
NP03428
FYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL
47