Browse by modification
Total number of results for Amidation are 3481
Download as  Fasta  All
NPID Sequence Length Organism Family Name PMID Peptide_REF
NP00039
YRQSLNNFQGLRSFGCRFGTCTVQKLAHQIYHFTDKDKDGSAPRSKISPQGY
52 Bos taurus Adrenomedullin Adrenomedullin
NP00041
ARLDVAAEFRKKWNKWALSR
20 Bos taurus Adrenomedullin Proadrenomedullin N-20 terminal peptide
NP00042
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY
47 Homo sapiens Adrenomedullin Adrenomedullin-2 (By similarity)
NP00043
VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY
40 Homo sapiens Adrenomedullin Intermedin-short (Potential)
NP00044
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
52 Homo sapiens Adrenomedullin Adrenomedullin 8387282# Kitamura K., Kangawa K., Kawamoto M., Ichiki Y., Nakamura S., Matsuo H., Eto T.; # "Adrenomedullin: a novel hypotensive peptide isolated from human pheochromocytoma."; # Biochem. Biophys. Res. Commun. 192:553-560(1993).
NP00045
ARLDVASEFRKKWNKWALSR
20 Homo sapiens Adrenomedullin Proadrenomedullin N-20 terminal peptide
NP00046
PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY
47 Mus musculus Adrenomedullin Adrenomedullin-2 (By similarity)
NP00047
VGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY
40 Mus musculus Adrenomedullin Intermedin-short (Potential)
NP00048
YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY
50 Mus musculus Adrenomedullin Adrenomedullin
NP00049
AGPDTPSQFRKKWNKWALSR
20 Mus musculus Adrenomedullin Proadrenomedullin N-20 terminal peptide
NP00050
PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY
47 Rattus norvegicus Adrenomedullin Adrenomedullin-2 (By similarity)
NP00051
VGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY
40 Rattus norvegicus Adrenomedullin Intermedin-short (Potential)
NP00052
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY
50 Rattus norvegicus Adrenomedullin Adrenomedullin
NP00053
ARLDTSSQFRKKWNKWALSR
20 Rattus norvegicus Adrenomedullin Proadrenomedullin N-20 terminal peptide
NP00054
EVNFSPSW
8 Anax junius AKH/HRTH/RPCH Anaim-AKH 21070783#Gäde G, Simek P, Fescemyer HW#Adipokinetic hormones provide inference for the phylogeny of odonata#J Insect Physiol 2011 Jan;57(1):174-8
NP00055
ELTFTPAW
8 Anopheles gambiae AKH/HRTH/RPCH Anoga-HrTH hormone 23439319#Mugumbate G, Jackson GE, van der Spoel D, Kövér KE, Szilágyi L#Anopheles gambiae, Anoga-HrTH hormone, free and bound structure--a nuclear magnetic resonance experiment#Peptides 2013 Mar;41:94-100
NP00056
ELNYSPDW
8 Anoplotrupes stercorosus AKH/HRTH/RPCH Mem-CC 2039445#Gäde G#A unique charged tyrosine-containing member of the adipokinetic hormone/red-pigment-concentrating hormone peptide family isolated and sequenced from two beetle species#Biochem J 1991 May 1;275 ( Pt 3):671-7
NP00057
VNFSPGWGT
9 Blattella germanica AKH/HRTH/RPCH hypertrehalosemic neuropeptide 2080017#Veenstra JA, Camps F#Structure of the hypertrehalosemic neuropeptide of the German cockroach, Blattella germanica#Neuropeptides 1990 Feb;15(2):107-9
NP00058
ELTFTPNWGT
10 Carausius morosus AKH/HRTH/RPCH Cam-HrTH-II 1482345#Gäde G, Kellner R, Rinehart KL, Proefke ML#A tryptophan-substituted member of the AKH/RPCH family isolated from a stick insect corpus cardiacum#Biochem Biophys Res Commun 1992 Dec 30;189(3):1303-9
NP00059
EVNFSPNW
8 Cerambycidae AKH/HRTH/RPCH Pea-CAH-I 10980303#Gäde G, Auerswald L#Flight substrates and their regulation by a member of the AKH/RPCH family of neuropeptides in Cerambycidae#J Insect Physiol 2000 Dec 1;46(12):1575-1584
NP00060
ELNFSTGW
8 Coreidae AKH/HRTH/RPCH Scg-AKH-II 17070834#Gäde G, Auerswald L, Marco HG#Flight fuel and neuropeptidergic control of fuel mobilisation in the twig wilter, Holopterna alata (Hemiptera, Coreidae)#J Insect Physiol 2006 Nov-Dec;52(11-12):1171-81
NP00061
ELTFSPDW
8 Drosophila melanogaster AKH/HRTH/RPCH Adipokinetic hormone 2117437#Schaffer MH, Noyes BE, Slaughter CA, Thorne GC, Gaskell SJ#The fruitfly Drosophila melanogaster contains a novel charged adipokinetic-hormone-family peptide#Biochem J 1990 Jul 15;269(2):315-20
NP00062
EVNFTPNW
8 Empusa pennata AKH/HRTH/RPCH Emp-AKH 2054098#Gäde G#The adipokinetic neuropeptide of Mantodea#Sequence elucidation and evolutionary relationships Biol Chem Hoppe Seyler 1991 Mar;372(3):193-201
NP00063
EVNFSPTW
8 Galloisiana yuasai AKH/HRTH/RPCH Adipokinetic hormone 19857536#Gäde G, Simek P#A novel member of the adipokinetic peptide family in a "living fossil", the ice crawler Galloisiana yuasai, is the first identified neuropeptide from the order Grylloblattodea#Peptides 2010 Mar;31(3):372-6
NP00064
ELTFSSGWGN
10 Helicoverpa zea AKH/HRTH/RPCH neuropeptide hormone 3415690#Jaffe H, Raina AK, Riley CT, Fraser BA, Bird TG, Tseng CM, Zhang YS, Hayes DK#Isolation and primary structure of a neuropeptide hormone from Heliothis zea with hypertrehalosemic and adipokinetic activities#Biochem Biophys Res Commun 1988 Aug 30;155(1):344-50
NP00065
EVNFSPNW
8 Leptinotarsa decemlineata AKH/HRTH/RPCH Led-CC-I 2576128#Gäde G, Kellner R#The metabolic neuropeptides of the corpus cardiacum from the potato beetle and the American cockroach are identical#Peptides 1989 Nov-Dec;10(6):1287-9
NP00066
ELTFTPNW
8 Leptinotarsa decemlineata AKH/HRTH/RPCH Led-CC-II 2576128#Gäde G, Kellner R#The metabolic neuropeptides of the corpus cardiacum from the potato beetle and the American cockroach are identical#Peptides 1989 Nov-Dec;10(6):1287-9
NP00068
ELNFTPNWGT
10 Melanoplus sanguinipes AKH/HRTH/RPCH Adipokinetic hormone 9367843#Taub-Montemayor TE, Linse KD, Rankin MA#Isolation and characterization of Melanoplus sanguinipes adipokinetic hormone: a new member of the AKH/RPCH family#Biochem Biophys Res Commun 1997 Oct 29;239(3):763-8
NP00069
ELNYSPDW
8 Melolontha melolontha AKH/HRTH/RPCH Mem-CC 2039445#Gäde G#A unique charged tyrosine-containing member of the adipokinetic hormone/red-pigment-concentrating hormone peptide family isolated and sequenced from two beetle species#Biochem J 1991 May 1;275 ( Pt 3):671-7
NP00070
EINFTPNW
8 Microhodotermes viator AKH/HRTH/RPCH Microhodotermes viator corpus cardiacum peptide 7479284#Liebrich W, Kellner R, Gäde G#Isolation and primary structures of neuropeptides of the AKH/RPCH family from various termite species#Peptides 1995;16(4):559-64
NP00071
ELNFSPNWGN
10 NA AKH/HRTH/RPCH Del-CC 11289079#Nair MM, Jackson GE, Gäde G#Conformational study of insect adipokinetic hormones using NMR constrained molecular dynamics#J Comput Aided Mol Des 2001 Mar;15(3):259-70
NP00072
EVNFSPSWGN
10 NA AKH/HRTH/RPCH Magicicada species-adipokinetic hormone 7550248#Raina A, Pannell L, Kochansky J, Jaffe H#Primary structure of a novel neuropeptide isolated from the corpora cardiaca of periodical cicadas having adipokinetic and hypertrehalosemic activities#Insect Biochem Mol Biol 1995 Sep;25(8):929-32
NP00073
EVNFSPGWGT
10 Nauphoeta cinerea AKH/HRTH/RPCH hypertrehalosaemic neuropeptide 3801028#Gäde G, Rinehart KL Jr#Amino acid sequence of a hypertrehalosaemic neuropeptide from the corpus cardiacum of the cockroach, Nauphoeta cinerea#Biochem Biophys Res Commun 1986 Dec 15;141(2):774-81
NP00074
VNFSPNW
7 Periplaneta americana AKH/HRTH/RPCH Periplanetin CC-1 9431551#Sieklucka-Dziuba M, Morawska D, Lombarska-Sliwińska D, Konopińska D, Kleinrok Z#Central action of insect neuropeptide, periplanetin CC-1, in mice#Pol J Pharmacol 1997 Jan-Feb;49(1):43-8
NP00075
ELTFTPNWGS
10 Phymateus leprosus AKH/HRTH/RPCH Adipokinetic hormone 7480874#Gäde G, Kellner R#Isolation and primary structure of a novel adipokinetic peptide from the pyrgomorphid grasshopper, Phymateus leprosus#Regul Pept 1995 Jun 27;57(3):247-52
NP00076
EITFTPNW
8 Polyphaga aegyptiaca AKH/HRTH/RPCH Poa-HrTH 1505721#Gäde G, Kellner R#Primary structures of the hypertrehalosemic peptides from corpora cardiaca of the primitive cockroach Polyphaga aegyptiaca#Gen Comp Endocrinol 1992 Apr;86(1):119-27
NP00077
ELNFSPNW
8 Polyphaga aegyptiaca AKH/HRTH/RPCH Tem-HrTH 1505721#Gäde G, Kellner R#Primary structures of the hypertrehalosemic peptides from corpora cardiaca of the primitive cockroach Polyphaga aegyptiaca#Gen Comp Endocrinol 1992 Apr;86(1):119-27
NP00078
ELTFSPDW
8 Protophormia terraenovae AKH/HRTH/RPCH Phormia terraenovae hypertrehalosaemic hormone 2386478#Gäde G, Wilps H, Kellner R#Isolation and structure of a novel charged member of the red-pigment-concentrating hormone-adipokinetic hormone family of peptides isolated from the corpora cardiaca of the blowfly Phormia terraenovae (Diptera)#Biochem J 1990 Jul 15;269(2):309-13
NP00079
ELNFTPNW
8 Pyrrhocoris apterus AKH/HRTH/RPCH Adipokinetic hormone 10802240#Kodrík D, Socha R, Simek P, Zemek R, Goldsworthy GJ#A new member of the AKH/RPCH family that stimulates locomotory activity in the firebug, Pyrrhocoris apterus (Heteroptera)#Insect Biochem Mol Biol 2000 Jun;30(6):489-98
NP00080
ELTFTPNW
8 Pyrrhocoris apterus AKH/HRTH/RPCH Pea-CAH-II 11836011#Kodrík D, Simek P, Lepsa L, Socha R#Identification of the cockroach neuropeptide Pea-CAH-II as a second adipokinetic hormone in the firebug Pyrrhocoris apterus#Peptides 2002 Mar;23(3):585-7
NP00081
EVNFTPNWGT
10 Romalea microptera AKH/HRTH/RPCH Ro I 3226948#Gäde G, Hilbich C, Beyreuther K, Rinehart KL#Sequence analyses of two neuropeptides of the AKH/RPCH-family from the lubber grasshopper, Romalea microptera#Peptides 1988 Jul-Aug;9(4):681-8
NP00082
EVNFSTGW
8 Romalea microptera AKH/HRTH/RPCH Ro II 3226948#Gäde G, Hilbich C, Beyreuther K, Rinehart KL#Sequence analyses of two neuropeptides of the AKH/RPCH-family from the lubber grasshopper, Romalea microptera#Peptides 1988 Jul-Aug;9(4):681-8
NP00083
ELNFTPNWGT
10 Schistocerca gregaria AKH/HRTH/RPCH Adipokinetic hormone 3063256#Isaac RE#Neuropeptide-degrading endopeptidase activity of locust (Schistocerca gregaria) synaptic membranes#Biochem J 1988 Nov 1;255(3):843-7
NP00084
ELNFSWGT
8 Schistocerca gregaria AKH/HRTH/RPCH Adipokinetic hormone 2 1601107#O'Shea M, Rayne RC#Adipokinetic hormones: cell and molecular biology#Experientia 1992 May 15;48(5):430-8 Review
NP00085
ELTFTPGW
8 Tabanus atratus AKH/HRTH/RPCH Tabanus atratus adipokinetic hormone 2813385#Jaffe H, Raina AK, Riley CT, Fraser BA, Nachman RJ, Vogel VW, Zhang YS, Hayes DK#Primary structure of two neuropeptide hormones with adipokinetic and hypotrehalosemic activity isolated from the corpora cardiaca of horse flies (Diptera)#Proc Natl Acad Sci U S A 1989 Oct;86(20):8161-4
NP00086
ELTFTPGWGY
10 Tabanus atratus AKH/HRTH/RPCH Tabanus atratus hypotrehalosemic hormone 2813385#Jaffe H, Raina AK, Riley CT, Fraser BA, Nachman RJ, Vogel VW, Zhang YS, Hayes DK#Primary structure of two neuropeptide hormones with adipokinetic and hypotrehalosemic activity isolated from the corpora cardiaca of horse flies (Diptera)#Proc Natl Acad Sci U S A 1989 Oct;86(20):8161-4
NP00087
QVNFSTGW
8 Acheta domesticus AKH/HRTH/RPCH Adipokinetic hormone 9367843#Taub-Montemayor TE, Linse KD, Rankin MA#Isolation and characterization of Melanoplus sanguinipes adipokinetic hormone: a new member of the AKH/RPCH family#Biochem Biophys Res Commun 1997 Oct 29;239(3):763-8
NP00088
QLNFSTGW
8 Anabrus simplex AKH/HRTH/RPCH Adipokinetic hormone 2 9367843#Taub-Montemayor TE, Linse KD, Rankin MA#Isolation and characterization of Melanoplus sanguinipes adipokinetic hormone: a new member of the AKH/RPCH family#Biochem Biophys Res Commun 1997 Oct 29;239(3):763-8
NP00089
EVNFSPSW
8 Anax imperator AKH/HRTH/RPCH Anaim-AKH 22885738#Gäde G, Marco HG#The adipokinetic hormone (AKH) of one of the most basal orders of Pterygota: structure and function of Ephemeroptera AKH#J Insect Physiol 2012 Nov;58(11):1390-6
NP00090
EVNFTPSW
8 Anax imperator AKH/HRTH/RPCH Anaim-AKH (1) 15749116#Gäde G, Marco HG#The adipokinetic hormones of Odonata: a phylogenetic approach#J Insect Physiol 2005 Mar;51(3):333-41
NP00091
EVNFTPSW
8 Anax junius AKH/HRTH/RPCH Anaim-AKH 21070783#Gäde G, Simek P, Fescemyer HW#Adipokinetic hormones provide inference for the phylogeny of odonata#J Insect Physiol 2011 Jan;57(1):174-8
NP00092
ELNFSPGW
8 Callinectes sapidus AKH/HRTH/RPCH Red pigment-concentrating hormone 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29
NP00093
QLNFSPGW
8 Cancer borealis AKH/HRTH/RPCH Red pigment-concentrating hormone 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00094
EVNFSTSW
8 Daphnia pulex AKH/HRTH/RPCH Dappu-RPCH 22885738#Gäde G, Marco HG#The adipokinetic hormone (AKH) of one of the most basal orders of Pterygota: structure and function of Ephemeroptera AKH#J Insect Physiol 2012 Nov;58(11):1390-6
NP00095
ELTFSPDW
8 Delia radicum AKH/HRTH/RPCH Adipokinetic hormone 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40
NP00098
EVNFPTSW
8 Ephemeroptera AKH/HRTH/RPCH Adipokinetic hormone 22885738#Gäde G, Marco HG#The adipokinetic hormone (AKH) of one of the most basal orders of Pterygota: structure and function of Ephemeroptera AKH#J Insect Physiol 2012 Nov;58(11):1390-6
NP00099
GLNFSPSW
8 Ephemeroptera AKH/HRTH/RPCH Corpu-AKH 22885738#Gäde G, Marco HG#The adipokinetic hormone (AKH) of one of the most basal orders of Pterygota: structure and function of Ephemeroptera AKH#J Insect Physiol 2012 Nov;58(11):1390-6
NP00100
EVNFSTGW
8 Gryllus bimaculatus AKH/HRTH/RPCH Adipokinetic hormone 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8
NP00101
QLNFSPGW
8 Homarus americanus AKH/HRTH/RPCH Red pigment-concentrating hormone 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00102
EVNFSPYW
8 Lethocerus indicus AKH/HRTH/RPCH Letin-AKH 22885738#Gäde G, Marco HG#The adipokinetic hormone (AKH) of one of the most basal orders of Pterygota: structure and function of Ephemeroptera AKH#J Insect Physiol 2012 Nov;58(11):1390-6
NP00103
EVNFTPSW
8