Total number of results for Gastrin/cholecystokinin are 233
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02041 |
DYMGWMDF
|
8 | Calliphora vomitoria | Gastrin/cholecystokinin | Cholecystokinin 8 | 8118842#Duve H, Rehfeld JF, East P, Thorpe A#Localisation of sulfakinin neuronal pathways in the blowfly Calliphora vomitoria#Cell Tissue Res 1994 Jan;275(1):177-86 | |
| NP02042 |
DQFDDYGHMRF
|
11 | Calliphora vomitoria | Gastrin/cholecystokinin | Drosulfakinin II | 8118842#Duve H, Rehfeld JF, East P, Thorpe A#Localisation of sulfakinin neuronal pathways in the blowfly Calliphora vomitoria#Cell Tissue Res 1994 Jan;275(1):177-86 | |
| NP02043 |
FLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDF
|
36 | Gallus gallus | Gastrin/cholecystokinin | Gastrin | 3743781#Dimaline R, Young J, Gregory H#Isolation from chicken antrum, and primary amino acid sequence of a novel 36-residue peptide of the gastrin/CCK family#FEBS Lett 1986 Sep 15;205(2):318-22 | |
| NP02044 |
AGGSGGVGGEYDDYGHL/I
|
17 | Litopenaeus vannamei | Gastrin/cholecystokinin | Sulfakinin-1 | 12437988#Torfs P, Baggerman G, Meeusen T, Nieto J, Nachman RJ, Calderon J, De Loof A, Schoofs L#Isolation, identification, and synthesis of a disulfated sulfakinin from the central nervous system of an arthropods the white shrimp Litopenaeus vannamei#Biochem Biophys Res Commun 2002 Nov 29;299(2):312-20 | |
| NP02045 |
AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
|
58 | Mus musculus | Gastrin/cholecystokinin | Cholecystokinin-58 | 16904071#Reeve JR Jr, Rosenquist GL, Keire DA, Chew P, Nicholas HB, Davis MT Jr, Lee TD, Shively JE, Backus RC#Crucial role of position 40 for interactions of CCK-58 revealed by sequence of cat CCK-58#Biochem Biophys Res Commun 2006 Sep 29;348(3):819-25 | |
| NP02046 |
YMGWMDF
|
7 | NA | Gastrin/cholecystokinin | Cholecystokinin | 6737428#Penke B, Hajnal F, Lonovics J, Holzinger G, Kadar T, Telegdy G, Rivier J#Synthesis of potent heptapeptide analogues of cholecystokinin#J Med Chem 1984 Jul;27(7):845-9 | |
| NP02047 |
WMDF
|
4 | NA | Gastrin/cholecystokinin | Cholecystokinin 4 | 11044801#Verspohl EJ, LaMura M#Biological effects of newly synthesized cholecystokinin analogs#Horm Res 2000;53(4):177-84 | |
| NP02048 |
GWMDF
|
5 | NA | Gastrin/cholecystokinin | Cholecystokinin 5 | 3814577#Chérot P, Fournié-Zaluski MC, Laval J#Purification and characterization of an enkephalin-degrading dipeptidyl-aminopeptidase from porcine brain#Biochemistry 1986 Dec 16;25(25):8184-91 | |
| NP02049 |
AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
|
58 | NA | Gastrin/cholecystokinin | Cholecystokinin-58 | 6468664#Tatemoto K, Jörnvall H, Siimesmaa S, Halldén G, Mutt V#Isolation and characterization of cholecystokinin-58 (CCK-58) from porcine brain#FEBS Lett 1984 Sep 3;174(2):289-93 | |
| NP02050 |
VPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMD
|
69 | NA | Gastrin/cholecystokinin | Cholecystokinin-70 | 7925386#Johnsen AH#Identification of cholecystokinin from frog and turtle#Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia Eur J Biochem 1994 Sep 1;224(2):691-702 | |
| NP02051 |
DLLEALSQDQKLLMAKFLPHIYAELANREGNWHEDAALRPLHDHDYPGWMDF
|
52 | NA | Gastrin/cholecystokinin | Gastrin | 1633800#Johnsen AH, Rehfeld JF#Identification of cholecystokinin/gastrin peptides in frog and turtle#Evidence that cholecystokinin is phylogenetically older than gastrin Eur J Biochem 1992 Jul 15;207(2):419-28 | |
| NP02052 |
ASGPGPSHKIKDRDYLGWMDF
|
21 | Oncorhynchus mykiss | Gastrin/cholecystokinin | CCK-L | 11342099#Jensen H, Rourke IJ, Møller M, Jønson L, Johnsen AH#Identification and distribution of CCK-related peptides and mRNAs in the rainbow trout, Oncorhynchus mykiss#Biochim Biophys Acta 2001 Jan 26;1517(2):190-201 | |
| NP02053 |
DYLGWMDF
|
8 | Oncorhynchus mykiss | Gastrin/cholecystokinin | CCK-L | 11342099#Jensen H, Rourke IJ, Møller M, Jønson L, Johnsen AH#Identification and distribution of CCK-related peptides and mRNAs in the rainbow trout, Oncorhynchus mykiss#Biochim Biophys Acta 2001 Jan 26;1517(2):190-201 | |
| NP02054 |
ESDDYGHMRF
|
10 | Periplaneta americana | Gastrin/cholecystokinin | Leucosulfakinin-II | 2615921#Veenstra JA#Isolation and structure of two gastrin/CCK-like neuropeptides from the American cockroach homologous to the leucosulfakinins#Neuropeptides 1989 Oct;14(3):145-9 | |
| NP02055 |
ASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
|
69 | Pseudis bolbodactyla | Gastrin/cholecystokinin | Cholecystokinin-69 | 7925386#Johnsen AH#Identification of cholecystokinin from frog and turtle#Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia Eur J Biochem 1994 Sep 1;224(2):691-702 | |
| NP02056 |
DLLASLTHEQKQLIMSQLLPELLSELSNAEDHLHPMRDRDYAGWMDF
|
47 | Pseudis bolbodactyla | Gastrin/cholecystokinin | Gastrin | 1633800#Johnsen AH, Rehfeld JF#Identification of cholecystokinin/gastrin peptides in frog and turtle#Evidence that cholecystokinin is phylogenetically older than gastrin Eur J Biochem 1992 Jul 15;207(2):419-28 | |
| NP02057 |
RVDGNSDQKAVIGAMLAKDLQTRKAGSSTGRYAVLPNR
|
38 | Rana nigrovittata | Gastrin/cholecystokinin | Cholecystokinin | 17698250#Liu X, Wang Y, Cheng L, Song Y, Lai R#Isolation and cDNA cloning of cholecystokinin from the skin of Rana nigrovittata#Peptides 2007 Aug;28(8):1540-4 | |
| NP02058 |
ESDDYGHMRF
|
10 | Rhyparobia maderae | Gastrin/cholecystokinin | Leucosulfakinin-II | 3778455#Nachman RJ, Holman GM, Cook BJ, Haddon WF, Ling N#Leucosulfakinin-II, a blocked sulfated insect neuropeptide with homology to cholecystokinin and gastrin#Biochem Biophys Res Commun 1986 Oct 15;140(1):357-64 | |
| NP02059 |
DYLGWMDF
|
8 | Seriola quinqueradiata | Gastrin/cholecystokinin | Cholecystokinin 8 | 16242687#Murashita K, Fukada H, Hosokawa H, Masumoto T#Cholecystokinin and peptide Y in yellowtail (Seriola quinqueradiata): molecular cloning, real-time quantitative RT-PCR, and response to feeding and fasting#Gen Comp Endocrinol 2006 Feb;145(3):287-97 | |
| NP02060 |
FDDYGHMRF
|
9 | Aedes aegypti | Gastrin/cholecystokinin | Sulfakinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02061 |
GGGGEGEQFDDYGHMRF
|
17 | Aedes aegypti | Gastrin/cholecystokinin | Sulfakinin-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02062 |
QQFDDYGHLRF
|
11 | Apis mellifera | Gastrin/cholecystokinin | Sulfakinin | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP02063 |
QPDDYGHMRY
|
10 | Daphnia pulex | Gastrin/cholecystokinin | Sulfakinin 1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP02064 |
DFDDYGHMRF
|
10 | Daphnia pulex | Gastrin/cholecystokinin | Sulfakinin 2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP02065 |
QDDDYGHMRF
|
10 | Ixodes scapularis | Gastrin/cholecystokinin | Sulfakinin-1 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP02066 |
SDDYGHMRF
|
9 | Ixodes scapularis | Gastrin/cholecystokinin | Sulfakinin-2 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP02067 |
FDDYGHMRF
|
9 | Lucilia cuprina | Gastrin/cholecystokinin | Sulfakinin-1 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP02068 |
GGEEQFDDYGHMRF
|
14 | Lucilia cuprina | Gastrin/cholecystokinin | Sulfakinin-2 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP02069 |
QFDEYGHMRF
|
10 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-1 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02070 |
AGGSGGVGGEYDDYGHLRF
|
19 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-2 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02071 |
VGGEYDDYGHLRF
|
13 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-3 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02072 |
ETSDDYGHLRF
|
11 | Zophobas atratus | Gastrin/cholecystokinin | Sulfakinin-1 | 21067424#Marciniak P, Audsley N, Kuczer M, Rosinski G#Identification of myotropic neuropeptides from the brain and corpus cardiacum-corpus allatum complex of the beetle, Zophobas atratus#J Insect Sci 2010;10:156 | |
| NP02073 |
EQFEDYGHMRF
|
11 | Aptera fusca | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02074 |
EQFEDYGHMRF
|
11 | Archimandrita tessellata | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02075 |
EQFEDYGHMRF
|
11 | Bantua robusta | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02076 |
EQFEDYGHMRF
|
11 | Blaberus craniifer | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02077 |
EQFEDYGHMRF
|
11 | Blaptica dubia | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02078 |
EQFDDYGHMRF
|
11 | Blatta lateralis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02079 |
EQFDDYGHMRF
|
11 | Blatta orientalis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02080 |
EQFDDYGHMRF
|
11 | Blattella germanica | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02081 |
EQFEDYGHMRF
|
11 | Blepharodera discoidalis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02082 |
FDDYGHMRF
|
9 | Calliphora vomitoria | Gastrin/cholecystokinin | Callisulfakinin-1 | 7556217#Duve H., Thorpe A., Scott A.G., Johnsen A.H., Rehfeld J.F., Hines E., East P.D.; #The sulfakinins of the blowfly Calliphora vomitoria. Peptide isolation, gene cloning and expression studies.; #Eur. J. Biochem. 232:633-640(1995). | |
| NP02083 |
GGEEQFDDYGHMRF
|
14 | Calliphora vomitoria | Gastrin/cholecystokinin | Callisulfakinin-2 (Potential) | ||
| NP02084 |
NYYGWMDF
|
8 | Ciona intestinalis | Gastrin/cholecystokinin | Cionin | 2303439#Johnsen A.H., Rehfeld J.F.; #Cionin: a disulfotyrosyl hybrid of cholecystokinin and gastrin from the neural ganglion of the protochordate Ciona intestinalis.; #J. Biol. Chem. 265:3054-3058(1990). | |
| NP02085 |
EQFDDYGHMRF
|
11 | Cryptocercus darwini | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02086 |
EQFDDYGHMRF
|
11 | Cryptocercus kyebangensis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02087 |
GGEEQFDDYGHMRF
|
14 | Delia radicum | Gastrin/cholecystokinin | Sulfakinin | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP02088 |
FDDYGHMRF
|
9 | Delia radicum | Gastrin/cholecystokinin | Sulfakinin(6-14) | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP02089 |
EQFDDYGHMRF
|
11 | Deropeltis atra | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02090 |
EQFDDYGHMRF
|
11 | Deropeltis erythrocephala | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02091 |
EQFDDYGHMRF
|
11 | Deropeltis integerrima | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02092 |
EQFEDYGHMRF
|
11 | Diploptera punctata | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02093 |
NQKTISF
|
7 | Drosophila erecta | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02094 |
FDDYGHMRF
|
9 | Drosophila erecta | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02095 |
GGDDQFDDYGHMRF
|
14 | Drosophila erecta | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02096 |
NQKTISF
|
7 | Drosophila mauritiana | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02097 |
FDDYGHMRF
|
9 | Drosophila mauritiana | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02098 |
GGDDQFDDYGHMRF
|
14 | Drosophila mauritiana | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02099 |
NQKTMSF
|
7 | Drosophila melanogaster | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02100 |
FDDYGHMRF
|
9 | Drosophila melanogaster | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02101 |
GGDDQFDDYGHMRF
|
14 | Drosophila melanogaster | Gastrin/cholecystokinin | Drosulfakinin-2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP02102 |
HQRSTGF
|
7 | Drosophila pseudoobscura pseudoobscura | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02103 |
FDDYGHMRF
|
9 | Drosophila pseudoobscura pseudoobscura | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02104 |
GGDDQFDDYGHMRF
|
14 | Drosophila pseudoobscura pseudoobscura | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02105 |
NQKTISF
|
7 | Drosophila sechellia | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02106 |
FDDYGHMRF
|
9 | Drosophila sechellia | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02107 |
GGDDQFDDYGHMRF
|
14 | Drosophila sechellia | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02108 |
NQKAISF
|
7 | Drosophila simulans | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02109 |
FDDYGHMRF
|
9 | Drosophila simulans | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02110 |
GGDDQFDDYGHMRF
|
14 | Drosophila simulans | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02111 |
NQKIITF
|
7 | Drosophila teissieri | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02112 |
FDDYGHMRF
|
9 | Drosophila teissieri | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02113 |
GGDDQFDDYGHMRF
|
14 | Drosophila teissieri | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02114 |
NQKIITF
|
7 | Drosophila yakuba | Gastrin/cholecystokinin | Drosulfakinin-0 (Potential) | ||
| NP02115 |
FDDYGHMRF
|
9 | Drosophila yakuba | Gastrin/cholecystokinin | Drosulfakinin-1 (Potential) | ||
| NP02116 |
GGDDQFDDYGHMRF
|
14 | Drosophila yakuba | Gastrin/cholecystokinin | Drosulfakinin-2 (By similarity) | ||
| NP02117 |
EQFEDYGHMRF
|
11 | Elliptorhina sp. | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02118 |
EQFDDYGHMRF
|
11 | Ergaula capucina | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02119 |
EQFEDYGHMRF
|
11 | Eublaberus distanti | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02120 |
EQFEDYGHMRF
|
11 | Eublaberus posticus | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02121 |
EQFEDYGHMRF
|
11 | Eublaberus sp. | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02122 |
QSDDYGHMRF
|
10 | Eurycotis floridana | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02123 |
EQFEDYGHMRF
|
11 | Gromphadorhina grandidieri | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02124 |
EQFEDYGHMRF
|
11 | Gromphadorina portentosa | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02125 |
EQFEDYGHMRF
|
11 | Gyna cf. cafforum | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02126 |
EQFEDYGHMRF
|
11 | Gyna lurida | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02127 |
QLASDDYGHMRF
|
12 | Locusta migratoria | Gastrin/cholecystokinin | Sulfakinin | #Schoofs L., Holman G.L., Hayes T.K., Nachman R.J., de Loof A.; ##(In) McCaffery A., Wilson I. (eds.); | |
| NP02128 |
EQFEDYGHMRF
|
11 | Lucihormetica grossei | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02129 |
EQFEDYGHMRF
|
11 | Lucihormetica subcincta | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02130 |
EQFEDYGHMRF
|
11 | Lucihormetica verrucosa | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02131 |
EQFDDYGHMRF
|
11 | Mastotermes darwiniensis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02132 |
EQFDDYGHMRF
|
11 | Neostylopyga rhombifolia | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02133 |
EQFEDYGHMRF
|
11 | Panchlora sp. | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02134 |
EQFEDYGHMRF
|
11 | Panchlora viridis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02135 |
EQFEDYGHMRF
|
11 | Panesthia sp. | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02136 |
QSDDYGHMRF
|
10 | Periplaneta americana | Gastrin/cholecystokinin | Leucosulfakinin-2 | 2615921#Veenstra J.A.; #Isolation and structure of two gastrin/CCK-like neuropeptides from the American cockroach homologous to the leucosulfakinins.; #Neuropeptides 14:145-149(1989). | |
| NP02137 |
EQFDDYGHMRF
|
11 | Periplaneta americana | Gastrin/cholecystokinin | Sulfakinin-1 | 2615921#Veenstra J.A.; #Isolation and structure of two gastrin/CCK-like neuropeptides from the American cockroach homologous to the leucosulfakinins.; #Neuropeptides 14:145-149(1989).$10406966#Predel R., Brandt W., Kellner R., Rapus J., Nachman R.J., Gaede G.; #"Post-translational modifications of the insect sulfakinins: sulfation, pyroglutamate-formation and O-methylation of glutamic acid."; #Eur. J. Biochem. 263:552-560(1999).$19257902#Roth S., Fromm B., Gaede G., Predel R.; #"A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case."; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02138 |
EQFDDYGHMRF
|
11 | Periplaneta australasiae | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02139 |
EQFDDYGHMRF
|
11 | Periplaneta brunnea | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02140 |
EQFDDYGHMRF
|
11 | Periplaneta fuliginosa | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02141 |
EQFEDYGHMRF
|
11 | Perisphaeria ruficornis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02142 |
EQFDDYGHMRF
|
11 | Polyphaga aegyptiaca | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02143 |
EQFEDYGHMRF
|
11 | Princisia vanwaerbeki | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02144 |
EQFDDYGHMRF
|
11 | Pseudoderopeltis cf. bimaculata JT-2004 | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02145 |
EQFDDYGHMRF
|
11 | Pseudoderopeltis flavescens | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02146 |
EQFDDYGHMRF
|
11 | Pseudoderopeltis foveolata | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02147 |
EQFEDYGHMRF
|
11 | Pycnoscelus surinamensis | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02148 |
QFNEYGHMRF
|
10 | Rhodnius prolixus | Gastrin/cholecystokinin | Sulfakinin-1 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP02149 |
NSDEQFDDYGYMRF
|
14 | Rhodnius prolixus | Gastrin/cholecystokinin | Sulfakinin-2 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP02150 |
QSDDYGHMRF
|
10 | Rhyparobia maderae | Gastrin/cholecystokinin | Leucosulfakinin-2 | 3778455#Nachman R.J., Holman G.M., Cook B.J., Haddon W.F., Ling N.; #Leucosulfakinin-II, a blocked sulfated insect neuropeptide with homology to cholecystokinin and gastrin.; #Biochem. Biophys. Res. Commun. 140:357-364(1986). | |
| NP02151 |
EQFEDYGHMRF
|
11 | Rhyparobia maderae | Gastrin/cholecystokinin | Sulfakinin-1 | 3749893#Nachman R.J., Holman G.M., Haddon W.F., Ling N.; #Leucosulfakinin, a sulfated insect neuropeptide with homology to gastrin and cholecystokinin.; #Science 234:71-73(1986).$19257902#Roth S., Fromm B., Gaede G., Predel R.; #"A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case."; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02152 |
FDDYGHMRF
|
9 | Sarcophaga bullata | Gastrin/cholecystokinin | Neosulfakinin-1 | 1360367#Fonagy A., Schoofs L., Proost P., van Damme J., de Loof A.; #Isolation and primary structure of two sulfakinin-like peptides from the fleshfly, Neobellieria bullata.; #Comp. Biochem. Physiol. 103C:135-142(1992). | |
| NP02153 |
XXEEQFDDYGHMRF
|
14 | Sarcophaga bullata | Gastrin/cholecystokinin | Neosulfakinin-2 | 1360367#Fonagy A., Schoofs L., Proost P., van Damme J., de Loof A.; #Isolation and primary structure of two sulfakinin-like peptides from the fleshfly, Neobellieria bullata.; #Comp. Biochem. Physiol. 103C:135-142(1992). | |
| NP02154 |
EQFDDYGHMRF
|
11 | Symploce pallens | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02155 |
EQFDDYGHMRF
|
11 | Therea petiveriana | Gastrin/cholecystokinin | Sulfakinin-1 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP02156 |
KPSSDADEDNDEVERYVRGWASKIGQTLGKIAKVGLQGLMQPKREAMLRSAEAQGMIGTLTSKRIKQG
|
68 | Xenopus laevis | Gastrin/cholecystokinin | Prolevitide | ||
| NP02157 |
GWASKIGQTLGKIAKVGLQGLMQPK
|
25 | Xenopus laevis | Gastrin/cholecystokinin | Amphipathic peptide | ||
| NP02158 |
QGMIGTLTSKRIKQ
|
14 | Xenopus laevis | Gastrin/cholecystokinin | Levitide | 2830279#Poulter L., Terry A.S., Williams D.H., Giovannini M.G., Moore C.H., Gibson B.W.; #Levitide, a neurohormone-like peptide from the skin of Xenopus laevis. Peptide and peptide precursor cDNA sequences.; #J. Biol. Chem. 263:3279-3283(1988). | |
| NP02159 |
DWPEPPSQEQQQRFISRFLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDF
|
53 | Gallus gallus | Gastrin/cholecystokinin | Gastrin | 1523171#Bjørnskov I, Rehfeld JF, Johnsen AH#Identification of four chicken gastrins, obtained by processing at post-Phe bonds#Peptides 1992 May-Jun;13(3):595-601 | |
| NP02160 |
EPFDDYGHMRFG
|
12 | Gryllus bimaculatus | Gastrin/cholecystokinin | Sulfakinin-1 | 17488300#Meyering-Vos M, Müller A#Structure of the sulfakinin cDNA and gene expression from the Mediterranean field cricket Gryllus bimaculatus#Insect Mol Biol 2007 Aug;16(4):445-54 | |
| NP02161 |
QSDDYGHMRFG
|
11 | Gryllus bimaculatus | Gastrin/cholecystokinin | Sulfakinin-1 | 17488300#Meyering-Vos M, Müller A#Structure of the sulfakinin cDNA and gene expression from the Mediterranean field cricket Gryllus bimaculatus#Insect Mol Biol 2007 Aug;16(4):445-54 | |
| NP02162 |
AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF
|
58 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-58 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).$7134033#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Hawke D., Walsh J.H.#Partial structure of a large canine cholecystokinin (CCK58): amino acid sequence.#Peptides 3:687-691(1982).$12686463#Reeve J.R. Jr., Keire D.A., Coskun T., Green G.M., Evans C., Ho F.-J., Lee T.D., Davis M.T., Shively J.E., Solomon T.E.#Synthesis of biologically active canine CCK-58.#Regul. Pept. 113:71-77(2003).$15064233#Reeve J.R. Jr., Liddle R.A., McVey D.C., Vigna S.R., Solomon T.E., Keire D.A., Rosenquist G., Shively J.E., Lee T.D., Chew P., Green G.M., Coskun T.#Identification of nonsulfated cholecystokinin-58 in canine intestinal extracts and its biological properties.#Am. J. Physiol. 287:G326-G333(2004).$6093106#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Miller C., Walsh J.H.#Isolation of a large cholecystokinin precursor from canine brain.#Proc. Natl. Acad. Sci. U.S.A. 81:6565-6568(1984).$1713209#Reeve J.R. Jr., Eysselein V.E., Eberlein G.A., Chew P., Ho F.-J., Huebner V.D., Shively J.E., Lee T.D., Liddle R.A.#Characterization of canine intestinal cholecystokinin-58 lacking its carboxyl-terminal nonapeptide. Evidence for similar post-translational processing in brain and gut.#J. Biol. Chem. 266:13770-13776(1991). | |
| NP02163 |
AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISD
|
49 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-58 desnonopeptide | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986).$7134033#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Hawke D., Walsh J.H.#Partial structure of a large canine cholecystokinin (CCK58): amino acid sequence.#Peptides 3:687-691(1982).$12686463#Reeve J.R. Jr., Keire D.A., Coskun T., Green G.M., Evans C., Ho F.-J., Lee T.D., Davis M.T., Shively J.E., Solomon T.E.#Synthesis of biologically active canine CCK-58.#Regul. Pept. 113:71-77(2003).$15064233#Reeve J.R. Jr., Liddle R.A., McVey D.C., Vigna S.R., Solomon T.E., Keire D.A., Rosenquist G., Shively J.E., Lee T.D., Chew P., Green G.M., Coskun T.#Identification of nonsulfated cholecystokinin-58 in canine intestinal extracts and its biological properties.#Am. J. Physiol. 287:G326-G333(2004).$6093106#Eysselein V.E., Reeve J.R. Jr., Shively J.E., Miller C., Walsh J.H.#Isolation of a large cholecystokinin precursor from canine brain.#Proc. Natl. Acad. Sci. U.S.A. 81:6565-6568(1984).$1713209#Reeve J.R. Jr., Eysselein V.E., Eberlein G.A., Chew P., Ho F.-J., Huebner V.D., Shively J.E., Lee T.D., Liddle R.A.#Characterization of canine intestinal cholecystokinin-58 lacking its carboxyl-terminal nonapeptide. Evidence for similar post-translational processing in brain and gut.#J. Biol. Chem. 266:13770-13776(1991). | |
| NP02164 |
YIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF
|
39 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-39 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02165 |
KAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF
|
33 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-33 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02166 |
VIKNLQNLDPSHRISDRDYMGWMDF
|
25 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-25 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02167 |
LDPSHRISDRDYMGWMDF
|
18 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-18 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02168 |
ISDRDYMGWMDF
|
12 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-12 (By similarity) | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02169 |
DYMGWMDF
|
8 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-8 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02170 |
YMGWMDF
|
7 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-7 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02171 |
GWMDF
|
5 | Canis familiaris | Gastrin/cholecystokinin | Cholecystokinin-5 | 2430967#Reeve J.R. Jr., Eysselein V.E., Walsh J.H., Ben-Avram C.M., Shively J.E.#New molecular forms of cholecystokinin. Microsequence analysis of forms previously characterized by chromatographic methods.# J. Biol. Chem. 261:16392-16397(1986). | |
| NP02172 |
QLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDF
|
34 | Canis familiaris | Gastrin/cholecystokinin | Big gastrin | 3763441#Bonato C., Eng J., Hulmes J.D., Miedel M., Pan Y.-C.E., Yalow R.S.#Sequences of gastrins purified from a single antrum of dog and of goat.# Peptides 7:689-693(1986).$5799207#Agarwal K.L., Kenner G.W., Sheppard R.C.#Structure and synthesis of canine gastrin.#Experientia 25:346-348(1969). | |
| NP02173 |
QGPWMEEEEAAYGWMDF
|
17 | Canis familiaris | Gastrin/cholecystokinin | Gastrin | 5799207#Agarwal K.L., Kenner G.W., Sheppard R.C.#Structure and synthesis of canine gastrin.#Experientia 25:346-348(1969). | |
| NP02174 |
QLGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF
|
34 | Equus caballus | Gastrin/cholecystokinin | Big gastrin | 9716385#Johnsen A.H., Sandin A., Rourke I.J., Bundgaard J.R., Nilsson G., Rehfeld J.F.#Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.# Eur. J. Biochem. 255:432-438(1998). | |
| NP02175 |
QGPWLEKEEAAYGWMDF
|
17 | Equus caballus | Gastrin/cholecystokinin | Gastrin | 9716385#Johnsen A.H., Sandin A., Rourke I.J., Bundgaard J.R., Nilsson G., Rehfeld J.F.#Unique progastrin processing in equine G-cells suggests marginal tyrosyl sulfotransferase activity.# Eur. J. Biochem. 255:432-438(1998). | |
| NP02176 |
QLGLQGPPQQVADLSKKQGPWLEEEEAAYGWMDF
|
34 | Felis catus | Gastrin/cholecystokinin | Big gastrin | 5784957#Agarwal K.L., Kenner G.W., Sheppard R.C.#Feline gastrin. An example of peptide sequence analysis by mass spectrometry.# J. Am. Chem. Soc. 91:3096-3097(1969). | |
| NP02177 |
QGPWLEEEEAAYGWMDF
|
17 | Felis catus | Gastrin/cholecystokinin | Gastrin | 5784957#Agarwal K.L., Kenner G.W., Sheppard R.C.#Feline gastrin. An example of peptide sequence analysis by mass spectrometry.# J. Am. Chem. Soc. 91:3096-3097(1969). | |
| NP02178 |
QQPAGSHDGSPVAAELQQSLTEPHRHSRAPSSAGPLKPAPRLDGSFEQRATIGALLAKYLQQARKGSTGRFSVLGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
|
110 | Gallus gallus | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02179 |
APSSAGPLKPAPRLDGSFEQRATIGALLAKYLQQARKGSTGRFSVLGNRVQSIDPTHRINDRDYMGWMDF
|
70 | Gallus gallus | Gastrin/cholecystokinin | Cholecystokinin-70 (Probable) | ||
| NP02180 |
DYMGWMDF
|
8 | Gallus gallus | Gastrin/cholecystokinin | Cholecystokinin-8 | 3620999#Fan Z.-W., Eng J., Miedel M., Hulmes J.D., Pan Y.-C., Yalow R.S.#Cholecystokinin octapeptides purified from chinchilla and chicken brains.# Brain Res. Bull. 18:757-760(1987). | |
| NP02181 |
YMGWMDF
|
7 | Gallus gallus | Gastrin/cholecystokinin | Cholecystokinin-7 (By similarity) | 3620999#Fan Z.-W., Eng J., Miedel M., Hulmes J.D., Pan Y.-C., Yalow R.S.#Cholecystokinin octapeptides purified from chinchilla and chicken brains.# Brain Res. Bull. 18:757-760(1987). | |
| NP02182 |
QQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
|
110 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02183 |
RIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
|
58 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-58 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02184 |
GSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
|
33 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-33 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02185 |
DYMGWMDF
|
8 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-8 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02186 |
YMGWMDF
|
7 | Lithobates catesbeiana | Gastrin/cholecystokinin | Cholecystokinin-7 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02187 |
QPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
|
95 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02188 |
AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
|
58 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-58 (By similarity) | ||
| NP02189 |
AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISD
|
49 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-58 desnonopeptide (By similarity) | ||
| NP02190 |
YIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
|
39 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-39 (By similarity) | ||
| NP02191 |
KAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
|
33 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-33 (By similarity) | ||
| NP02192 |
IIKNLQNLDPSHRISDRDYMGWMDF
|
25 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-25 (By similarity) | ||
| NP02193 |
LDPSHRISDRDYMGWMDF
|
18 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-18 (By similarity) | ||
| NP02194 |
ISDRDYMGWMDF
|
12 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-12 (By similarity) | ||
| NP02195 |
DYMGWMDF
|
8 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-8 (By similarity) | ||
| NP02196 |
YMGWMDF
|
7 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-7 (By similarity) | ||
| NP02197 |
GWMDF
|
5 | Macaca fascicularis | Gastrin/cholecystokinin | Cholecystokinin-5 (By similarity) | ||
| NP02198 |
QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF
|
34 | Ovis aries | Gastrin/cholecystokinin | Big gastrin | 5665711#Agarwal K.L., Beacham J., Bentley P.H., Gregory R.A., Kenner G.W., Sheppard R.C., Tracy H.J.#Isolation, structure and synthesis of ovine and bovine gastrins.# Nature 219:614-615(1968). | |
| NP02199 |
QGPWVEEEEAAYGWMDF
|
17 | Ovis aries | Gastrin/cholecystokinin | Gastrin | 5665711#Agarwal K.L., Beacham J., Bentley P.H., Gregory R.A., Kenner G.W., Sheppard R.C., Tracy H.J.#Isolation, structure and synthesis of ovine and bovine gastrins.# Nature 219:614-615(1968). | |
| NP02200 |
HPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
|
115 | Paralichthys olivaceus | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02201 |
DYLGWMDF
|
8 | Paralichthys olivaceus | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02202 |
DYMGWMDF
|
8 | Python molurus | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02203 |
QQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
|
110 | Struthio camelus | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02204 |
APSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDF
|
70 | Struthio camelus | Gastrin/cholecystokinin | Cholecystokinin-70 (Probable) | ||
| NP02205 |
DYMGWMDF
|
8 | Struthio camelus | Gastrin/cholecystokinin | Cholecystokinin-8 | 11072120#Jonson L., Schoeman N., Saayman H., Naude R., Jensen H., Johnsen A.H.#Identification of ostrich and chicken cholecystokinin cDNA and intestinal peptides.# Peptides 21:1337-1344(2000). | |
| NP02206 |
YMGWMDF
|
7 | Struthio camelus | Gastrin/cholecystokinin | Cholecystokinin-7 | 11072120#Jonson L., Schoeman N., Saayman H., Naude R., Jensen H., Johnsen A.H.#Identification of ostrich and chicken cholecystokinin cDNA and intestinal peptides.# Peptides 21:1337-1344(2000). | |
| NP02207 |
QPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
|
94 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02208 |
AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
|
58 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-58 | ||
| NP02209 |
VQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDR
|
49 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-58 desnonopeptide (By similarity) | ||
| NP02210 |
YIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
|
39 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-39 | ||
| NP02211 |
KAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
|
33 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-33 | #Mutt V., Jorpes J.E.## Submitted (AUG-1970) to the PIR data bank. | |
| NP02212 |
IKNLQSLDPSHRISDRDYMGWMDFG
|
25 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-25 (By similarity) | ||
| NP02213 |
DPSHRISDRDYMGWMDFG
|
18 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-18 (By similarity) | ||
| NP02214 |
ISDRDYMGWMDF
|
12 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-12 | 5410106#Ondetti M.A., Pluscec J., Sabo E.F., Sheehan J.T., Williams N.#Synthesis of cholecystokinin-pancreozymin. I. The C-terminal dodecapeptide.#J. Am. Chem. Soc. 92:195-199(1970). | |
| NP02215 |
DYMGWMDF
|
8 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02216 |
MGWMDFG
|
7 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-7 (By similarity) | ||
| NP02217 |
WMDFG
|
5 | Sus scrofa | Gastrin/cholecystokinin | Cholecystokinin-5 (By similarity) | ||
| NP02218 |
QLGLQGPPHLVADLAKKQGPWMEEEEEAYGWMDF
|
34 | Sus scrofa | Gastrin/cholecystokinin | Big gastrin | 14248711#Gregory H., Hardy P.M., Jones D.S., Kenner G.W., Sheppard R.C.#The antral hormone gastrin. Structure of gastrin.# Nature 204:931-933(1964). | |
| NP02219 |
QGPWMEEEEEAYGWMDF
|
17 | Sus scrofa | Gastrin/cholecystokinin | Gastrin | 14248711#Gregory H., Hardy P.M., Jones D.S., Kenner G.W., Sheppard R.C.#The antral hormone gastrin. Structure of gastrin.# Nature 204:931-933(1964). | |
| NP02220 |
QQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
|
110 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02221 |
RLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
|
58 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-58 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02222 |
YLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
|
40 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-40 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02223 |
GPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
|
33 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-33 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02224 |
DYMGWMDF
|
8 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-8 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02225 |
YMGWMDF
|
7 | Trachemys scripta | Gastrin/cholecystokinin | Cholecystokinin-7 | 7925386#Johnsen A.H.#Identification of cholecystokinin from frog and turtle. Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia.# Eur. J. Biochem. 224:691-702(1994). | |
| NP02226 |
GTNGKPPDPKKESQDYLGWMDF
|
22 | Varanus varius | Gastrin/cholecystokinin | Cholecystoxin-22 | ||
| NP02227 |
DYLGWMDF
|
8 | Varanus varius | Gastrin/cholecystokinin | Cholecystoxin-8 | ||
| NP02228 |
DYMGWMDF
|
8 | Xenopus laevis | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02229 |
QPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS
|
95 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02230 |
ISDRDYMGWMDF
|
12 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-12 | ||
| NP02231 |
LDPSHRISDRDYMGWMDF
|
18 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-18 (By similarity) | ||
| NP02232 |
VIKNLQSLDPSHRISDRDYMGWMDF
|
25 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-25 (By similarity) | ||
| NP02233 |
KAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
|
33 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-33 | ||
| NP02234 |
YIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
|
39 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-39 | 4011954#Carlquist M., Mutt V., Joernvall H.; #"Characterization of two novel forms of cholecystokinin isolated from bovine upper intestine."; #Regul. Pept. 11:27-34(1985). | |
| NP02235 |
GWMDF
|
5 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-5 (By similarity) | ||
| NP02236 |
AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
|
58 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-58 | ||
| NP02237 |
AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISD
|
49 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-58 desnonopeptide (By similarity) | ||
| NP02238 |
YMGWMDF
|
7 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-7 (By similarity) | ||
| NP02239 |
DYMGWMDF
|
8 | Bos taurus | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02240 |
QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF
|
34 | Bos taurus | Gastrin/cholecystokinin | Big gastrin | ||
| NP02241 |
QGPWVEEEEAAYGWMDF
|
17 | Bos taurus | Gastrin/cholecystokinin | Gastrin | 5665711# Agarwal K.L., Beacham J., Bentley P.H., Gregory R.A., Kenner G.W., Sheppard R.C., Tracy H.J.; # "Isolation, structure and synthesis of ovine and bovine gastrins."; # Nature 219:614-615(1968). | |
| NP02242 |
QPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
|
95 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02243 |
ISDRDYMGWMDF
|
12 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-12 | ||
| NP02244 |
LDPSHRISDRDYMGWMDF
|
18 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-18 (By similarity) | ||
| NP02245 |
IVKNLQNLDPSHRISDRDYMGWMDF
|
25 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-25 (By similarity) | ||
| NP02246 |
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
|
33 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-33 | ||
| NP02247 |
YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
|
39 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-39 | ||
| NP02248 |
GWMDF
|
5 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-5 (By similarity) | ||
| NP02249 |
VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
|
58 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-58 | ||
| NP02250 |
VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISD
|
49 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-58 desnonopeptide (By similarity) | ||
| NP02251 |
YMGWMDF
|
7 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-7 (By similarity) | ||
| NP02252 |
DYMGWMDF
|
8 | Homo sapiens | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02253 |
QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
|
34 | Homo sapiens | Gastrin/cholecystokinin | Big gastrin | ||
| NP02254 |
QGPWLEEEEEAYGWMDF
|
17 | Homo sapiens | Gastrin/cholecystokinin | Gastrin | 5921183#Bentley P.H., Kenner G.W., Sheppard R.C.; #"Structures of human gastrins I and II."; #Nature 209:583-585(1966).$5822140#Gregory R.A., Tracy H.J., Agarwal K.L., Grossman M.I.; #"Aminoacid constitution of two gastrins isolated from Zollinger- Ellison tumour tissue."; #Gut 10:603-608(1969). | |
| NP02255 |
WLEEEEEAYGWMDF
|
14 | Homo sapiens | Gastrin/cholecystokinin | Gastrin-14 | ||
| NP02256 |
DLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
|
52 | Homo sapiens | Gastrin/cholecystokinin | Gastrin-52 | ||
| NP02257 |
YGWMDF
|
6 | Homo sapiens | Gastrin/cholecystokinin | Gastrin-6 | ||
| NP02258 |
SWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
|
71 | Homo sapiens | Gastrin/cholecystokinin | Gastrin-71 | ||
| NP02259 |
QPVVPAEATDPVEQRAQEAPRRQLRAVLRTDGEPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
|
95 | Mus musculus | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02260 |
ISDRDYMGWMDF
|
12 | Mus musculus | Gastrin/cholecystokinin | Cholecystokinin-12 | ||
| NP02261 |
KAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDF
|
33 | Mus musculus | Gastrin/cholecystokinin | Cholecystokinin-33 | ||
| NP02262 |
DYMGWMDF
|
8 | Mus musculus | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02263 |
QLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDF
|
34 | Mus musculus | Gastrin/cholecystokinin | Big gastrin | ||
| NP02264 |
QRPRMEEEEEAYGWMDF
|
17 | Mus musculus | Gastrin/cholecystokinin | Gastrin | ||
| NP02265 |
SWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDF
|
71 | Mus musculus | Gastrin/cholecystokinin | Gastrin-71 | ||
| NP02266 |
AVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
|
58 | Rattus norvegicus | Gastrin/cholecystokinin | Cholecystokinin | ||
| NP02267 |
ISDRDYMGWMDF
|
12 | Rattus norvegicus | Gastrin/cholecystokinin | Cholecystokinin-12 | ||
| NP02268 |
NLQGLDPSHRISDRDYMGWMDF
|
22 | Rattus norvegicus | Gastrin/cholecystokinin | Cholecystokinin-22 | ||
| NP02269 |
KAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
|
33 | Rattus norvegicus | Gastrin/cholecystokinin | Cholecystokinin-33 | ||
| NP02270 |
YIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
|
39 | Rattus norvegicus | Gastrin/cholecystokinin | Cholecystokinin-39 | ||
| NP02271 |
DYMGWMDF
|
8 | Rattus norvegicus | Gastrin/cholecystokinin | Cholecystokinin-8 | ||
| NP02272 |
QLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDF
|
34 | Rattus norvegicus | Gastrin/cholecystokinin | Big gastrin | ||
| NP02273 |
QRPPMEEEEEAYGWMDF
|
17 | Rattus norvegicus | Gastrin/cholecystokinin | Gastrin |