Total number of results for Tachykinin are 269
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05518 | GPPDPNKFIGLM |
12 | Agalychnis callidryas | Tachykinin | Tachykinin | 9145422#Mignogna G, Severini C, Erspamer GF, Siciliano R, Kreil G, Barra D#Tachykinins and other biologically active peptides from the skin of the Costa Rican phyllomedusid frog Agalychnis callidryas#Peptides 1997;18(3):367-72 | |
| NP05519 | SKSHQFYGLM |
10 | Amia calva | Tachykinin | Tachykinin | 7573557#Waugh D, Groff KE, Platzack B, Youson JH, Olson KR, Conlon JM#Isolation, localization, and cardiovascular activity of tachykinins from the stomach of the bowfin Amia calva#Am J Physiol 1995 Sep;269(3 Pt 2):R565-71 | |
| NP05520 | DNPSVGQFYGLM |
12 | Amphiuma tridactylum | Tachykinin | Substance P | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 | |
| NP05521 | APSGFLGVR |
9 | Blattella germanica | Tachykinin | Tachykinin-related peptide 1 | 18178289#Pascual N, Maestro JL, Chiva C, Andreu D, Bellés X#Identification of a tachykinin-related peptide with orexigenic properties in the German cockroach#Peptides 2008 Mar;29(3):386-92 | |
| NP05522 | KPRPDQFYGLM |
11 | Bufo marinus | Tachykinin | bufokinin | 15627485#Liu L, Murray M, Conlon JM, Burcher E#Quantitative structure-activity analyses of bufokinin and other tachykinins at bufokinin (bNK1) receptors of the small intestine of the cane toad, Bufo marinus#Biochem Pharmacol 2005 Jan 15;69(2):329-38 | |
| NP05523 | YPSGFLGMR |
9 | Callinectes sapidus | Tachykinin | Tachykinin-related peptide | 22247794#Hui L, Zhang Y, Wang J, Cook A, Ye H, Nusbaum MP, Li L#Discovery and functional study of a novel crustacean tachykinin neuropeptide#ACS Chem Neurosci 2011 Dec 21;2(12):711-722 | |
| NP05524 | APSGFLGMRG |
10 | Cancer borealis | Tachykinin | Tachykinin-related peptide Ia | 18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702 | |
| NP05525 | TPSGFLGMR |
9 | Cancer irroratus | Tachykinin | Tachykinin-related peptide | 17437551#Stemmler EA, Peguero B, Bruns EA, Dickinson PS, Christie AE#Identification, physiological actions, and distribution of TPSGFLGMRamide: a novel tachykinin-related peptide from the midgut and stomatogastric nervous system of Cancer crabs#J Neurochem 2007 Jun;101(5):1351-66 | |
| NP05526 | TPSGFLGMR |
9 | Cancer productus | Tachykinin | Tachykinin-related peptide | 17437551#Stemmler EA, Peguero B, Bruns EA, Dickinson PS, Christie AE#Identification, physiological actions, and distribution of TPSGFLGMRamide: a novel tachykinin-related peptide from the midgut and stomatogastric nervous system of Cancer crabs#J Neurochem 2007 Jun;101(5):1351-66 | |
| NP05527 | PSKDAFIGLM |
10 | Cavia porcellus | Tachykinin | Eledoisin | 2867901#O'Connor B, O'Cuinn G#Post-proline dipeptidyl-aminopeptidase from synaptosomal membranes of guinea-pig brain#A possible role for this activity in the hydrolysis of His-ProNH2, arising from the action of synaptosomal membrane pyroglutamate aminopeptidase on thyroliberin Eur J Biochem 1986 Jan 15;154(2):329-35 | |
| NP05528 | TPSGFLGMR |
9 | Homarus americanus | Tachykinin | Tachykinin-related peptide | 18706463#Christie AE, Cashman CR, Stevens JS, Smith CM, Beale KM, Stemmler EA, Greenwood SJ, Towle DW, Dickinson PS#Identification and cardiotropic actions of brain/gut-derived tachykinin-related peptides (TRPs) from the American lobster Homarus americanus#Peptides 2008 Nov;29(11):1909-18 | |
| NP05529 | RPKPQFFGLM |
10 | Homo sapiens | Tachykinin | Substance P | 8556479#Lee HR, Ho WZ, Douglas SD#Substance P augments tumor necrosis factor release in human monocyte-derived macrophages#Clin Diagn Lab Immunol 1994 Jul;1(4):419-23 | |
| NP05530 | HKDAFIGLM |
9 | Lampetra fluviatilis | Tachykinin | Neurokinin A | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 | |
| NP05531 | RKPHPKEFVGLM |
12 | Lampetra fluviatilis | Tachykinin | Substance P | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 | |
| NP05532 | TPSGFLGMR |
9 | Metacarcinus magister | Tachykinin | Tachykinin-related peptide | 17437551#Stemmler EA, Peguero B, Bruns EA, Dickinson PS, Christie AE#Identification, physiological actions, and distribution of TPSGFLGMRamide: a novel tachykinin-related peptide from the midgut and stomatogastric nervous system of Cancer crabs#J Neurochem 2007 Jun;101(5):1351-66 | |
| NP05533 | EPSKDAFIGLM |
11 | NA | Tachykinin | Eledoisin | 21472584#Li X, Huang Y, O'Connor PB, Lin C#Structural heterogeneity of doubly-charged peptide b-ions#J Am Soc Mass Spectrom 2011 Feb;22(2):245-54 | |
| NP05534 | EADPNKFYGLM |
11 | NA | Tachykinin | Physalaemin | 2428402#Chassaing G, Convert O, Lavielle S#Conformational analogy between substance P and physalaemin#Biochim Biophys Acta 1986 Oct 17;873(3):397-404 | |
| NP05535 | DDASDRAKKFYGLM |
14 | Odorrana margaretae | Tachykinin | Ranamargarin | 2803524#Tang YQ, Tian SH, Wu SX, Hua JC, Wu GF, Zhao EM, Lu YA, Zhu YQ, Zou G, Tsou K#Isolation and structure of ranamargarin, a new tachykinin from the skin of Chinese frog Rana margaratae#Sci China B 1989 May;32(5):570-9 | |
| NP05536 | SSANPQITRKRHKINSFVGLM |
21 | Oncorhynchus mykiss | Tachykinin | neuropeptide-gamma-related peptide | 7694488#Jensen J, Olson KR, Conlon JM#Primary structures and effects on gastrointestinal motility of tachykinins from the rainbow trout#Am J Physiol 1993 Oct;265(4 Pt 2):R804-10 | |
| NP05537 | RKPHPKEFVGLM |
12 | Petromyzon marinus | Tachykinin | Tachykinin | 8015973#Waugh D, Sower S, Bjenning C, Conlon JM#Novel tachykinins from the brain of the sea lamprey, Petromyzon marinus, and the skate, Raja rhina#Peptides 1994 Jan;15(1):155-61 | |
| NP05538 | KPKPHQFFGLM |
11 | Polyodon spathula | Tachykinin | Tachykinin | 10525358#Wang Y, Barton BA, Nielsen PF, Conlon JM#Tachykinins (substance P and neuropeptide gamma) from the brains of the pallid sturgeon, Scaphirhynchus albus and the paddlefish, Polyodon spathula (Acipenseriformes)#Gen Comp Endocrinol 1999 Oct;116(1):21-30 | |
| NP05539 | APSGFLGMR |
9 | Procambarus clarkii | Tachykinin | Tachykinin-related peptide | 15066180#Yasuda-Kamatani Y, Yasuda A#APSGFLGMRamide is a unique tachykinin-related peptide in crustaceans#Eur J Biochem 2004 Apr;271(8):1546-56 | |
| NP05540 | RPKPQQFGLM |
10 | Rattus norvegicus | Tachykinin | Substance P | 6196036#García-Sevilla JA, Magnusson T, Carlsson A, Folkers K#Substance P: structural requirements for the activation of brain catecholamine synthesis and locomotor activity in rats#Arzneimittelforschung 1983;33(9):1249-54 | |
| NP05541 | RPQQFGLM |
8 | Rattus norvegicus | Tachykinin | Substance P | 504332#Hecht K, Oehme P, Poppei M, Hecht T#Conditioned-reflex learning of normal juvenile and adult rats exposed to action of substance P and of an SP analogue#Pharmazie 1979 Jul;34(7):419-23 | |
| NP05542 | SKYHQFYGLM |
10 | Scaphirhynchus platorynchus | Tachykinin | Tachykinin | 9882542#Wang Y, Barton BA, Thim L, Nielsen PF, Conlon JM#Purification and characterization of galanin and scyliorhinin I from the hybrid sturgeon, Scaphirhynchus platorynchus x Scaphirhynchus albus (Acipenseriformes)#Gen Comp Endocrinol 1999 Jan;113(1):38-45 | |
| NP05543 | HKDAFIGLM |
9 | Sphyrna lewini | Tachykinin | Neurokinin A | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 | |
| NP05544 | DNPSVGQFYGLM |
12 | Sphyrna lewini | Tachykinin | Substance P | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 | |
| NP05545 | VPSGFTGMR |
9 | Aedes aegypti | Tachykinin | Tachykinin-related peptide 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05546 | VPNGFLGVR |
9 | Aedes aegypti | Tachykinin | Tachykinin-related peptide 5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05547 | APSGFLGLR |
9 | Aedes aegypti | Tachykinin | TKRP-1 and 4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05548 | APMGFYGTRG |
10 | Apis mellifera | Tachykinin | Tachykinin | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP05549 | APSGFLGMR |
9 | Callinectes sapidus | Tachykinin | Tachykinin-related peptide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
| NP05550 | TPSGFLGMR |
9 | Callinectes sapidus | Tachykinin | Tachykinin-related peptide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
| NP05551 | APSGFLGMR |
9 | Cancer borealis | Tachykinin | Tachykinin-related peptide | 23544036#Sturm RM, Greer T, Chen R, Hensen B, Li L#Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C#borealis brain tissue Anal Methods 2013;5(6):1623-1628 | |
| NP05552 | APSGFQ |
6 | Cancer borealis | Tachykinin | Tachykinin-related peptide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP05553 | GFLGMR |
6 | Cancer borealis | Tachykinin | Tachykinin-related peptide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP05554 | TPSGFLGMR |
9 | Cancer borealis | Tachykinin | Tachykinin-related peptide | 19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18 | |
| NP05555 | SGFLGMR |
7 | Cancer borealis | Tachykinin | Tachykinin-related peptide Ib | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
| NP05556 | APSGFLGMR |
9 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05557 | APSGFLGMRG |
10 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05558 | TPSGFLGMR |
9 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05559 | PSGFLGMR |
8 | Carcinus maenas | Tachykinin | Tachykinin-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05560 | SGFLGMR |
7 | Carcinus maenas | Tachykinin | Tachykinin-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05561 | HVRHFYGLM |
9 | Ciona intestinalis | Tachykinin | Ci-TK-I | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP05562 | NLLSLLQHAIETANNAYRSPR |
21 | Ciona intestinalis | Tachykinin | Ci-TK-II | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP05563 | SIGDQPSIFNERASFTGLM |
19 | Ciona intestinalis | Tachykinin | Ci-TK-II | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP05564 | HKTDSFVGLM |
10 | Coturnix coturnix japonica | Tachykinin | Neurokinin A | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05565 | AGYGQISH |
8 | Coturnix coturnix japonica | Tachykinin | Neuropeptide K | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05566 | DAGYGQISH |
9 | Coturnix coturnix japonica | Tachykinin | Neuropeptide K | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP05567 | APYGFTGMR |
9 | Culex salinarius | Tachykinin | CusTK II | 9316266#Christie AE, Lundquist CT, Nässel DR, Nusbaum MP#Two novel tachykinin-related peptides from the nervous system of the crab Cancer borealis#J Exp Biol 1997 Sep;200(Pt 17):2279-94 | |
| NP05568 | APSGFFGMR |
9 | Culex salinarius | Tachykinin | CusTK III | 9316266#Christie AE, Lundquist CT, Nässel DR, Nusbaum MP#Two novel tachykinin-related peptides from the nervous system of the crab Cancer borealis#J Exp Biol 1997 Sep;200(Pt 17):2279-94 | |
| NP05569 | APSGFMGMR |
9 | Culex salinarius | Tachykinin | Tachykinin-1 | 9316266#Christie AE, Lundquist CT, Nässel DR, Nusbaum MP#Two novel tachykinin-related peptides from the nervous system of the crab Cancer borealis#J Exp Biol 1997 Sep;200(Pt 17):2279-94 | |
| NP05570 | TPNSRAFLGMR |
11 | Daphnia pulex | Tachykinin | Tachykinin-related peptide 1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP05571 | KMHGEKFLGMR |
11 | Daphnia pulex | Tachykinin | Tachykinin-related peptide 2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP05572 | APSSNSFMGMR |
11 | Daphnia pulex | Tachykinin | Tachykinin-related peptide 3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP05573 | APSGFLGMR |
9 | Homarus americanus | Tachykinin | Tachykinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP05574 | APSGFLGMR |
9 | Homarus americanus | Tachykinin | Tachykinin | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP05575 | APSGFLGMRG |
10 | Homarus americanus | Tachykinin | Tachykinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP05576 | SGFLGMR |
7 | Homarus americanus | Tachykinin | Tachykinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP05577 | PSGFLGMR |
8 | Homarus americanus | Tachykinin | Tachykinin-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP05578 | GSGFFGMR |
8 | Ixodes scapularis | Tachykinin | Tachykinin-related peptide 2 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP05579 | AFHAMR |
6 | Ixodes scapularis | Tachykinin | TKRP-1 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP05580 | APAGFLGMR |
9 | Litopenaeus vannamei | Tachykinin | Tachykinin-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP05581 | APSGFLDMR |
9 | Litopenaeus vannamei | Tachykinin | Tachykinin-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP05582 | APSGFLGMR |
9 | Litopenaeus vannamei | Tachykinin | Tachykinin-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP05583 | APSGFLGMRG |
10 | Litopenaeus vannamei | Tachykinin | Tachykinin-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP05584 | APSGFNGMR |
9 | Litopenaeus vannamei | Tachykinin | Tachykinin-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP05585 | ASMRGFQGMR |
10 | Nasonia vitripennis | Tachykinin | Tachykinin-1 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05586 | APMGFQGMR |
9 | Nasonia vitripennis | Tachykinin | Tachykinin-2 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05587 | AMMGGFQGMR |
10 | Nasonia vitripennis | Tachykinin | Tachykinin-3 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05588 | ALLGFHGMR |
9 | Nasonia vitripennis | Tachykinin | Tachykinin-4 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05589 | PMMMGFHGMR |
10 | Nasonia vitripennis | Tachykinin | Tachykinin-5 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05590 | SPYRFFGTR |
9 | Nasonia vitripennis | Tachykinin | Tachykinin-6 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05591 | NPRWEMRGKFVGVR |
14 | Nasonia vitripennis | Tachykinin | Tachykinin-7 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05592 | APSGFLGMR |
9 | Ocypode ceratophthalma | Tachykinin | Tachykinin-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP05593 | APSGFLGMRG |
10 | Ocypode ceratophthalma | Tachykinin | Tachykinin-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP05594 | PSGFLGMR |
8 | Ocypode ceratophthalma | Tachykinin | Tachykinin-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP05595 | SGFLGMR |
7 | Ocypode ceratophthalma | Tachykinin | Tachykinin-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP05596 | TPSGFLGMR |
9 | Ocypode ceratophthalma | Tachykinin | Tachykinin-related peptide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP05597 | KPRPHQFIGLM |
11 | Oryzias latipes | Tachykinin | Substance P | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05598 | APSGFLGMR |
9 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05599 | APSGFQGMR |
9 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05600 | PSGFLGMR |
8 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05601 | LAQSQFVGSR |
10 | Urechis unicinctus | Tachykinin | UruTK I | 9316266#Christie AE, Lundquist CT, Nässel DR, Nusbaum MP#Two novel tachykinin-related peptides from the nervous system of the crab Cancer borealis#J Exp Biol 1997 Sep;200(Pt 17):2279-94 | |
| NP05602 | GPSGFLGMR |
9 | Acrosternum hilare | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05603 | APAAGFFGMR |
10 | Acrosternum hilare | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05604 | GPSSGFFGMR |
10 | Acrosternum hilare | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05605 | SPASGFFGMR |
10 | Acrosternum hilare | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05606 | APLMGFQGVR |
10 | Acrosternum hilare | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05607 | APSMGFMGMR |
10 | Acrosternum hilare | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05608 | NTGDKFYGLM |
10 | Aedes aegypti | Tachykinin | Sialokinin | 8278354#Champagne D.E., Ribeiro J.M.C.; #Sialokinin I and II: vasodilatory tachykinins from the yellow fever mosquito Aedes aegypti.; #Proc. Natl. Acad. Sci. U.S.A. 91:138-142(1994). | |
| NP05609 | ALMGFQGVR |
9 | Apis mellifera | Tachykinin | ALMGFQGVR-amide | 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05610 | APMGFQGMR |
9 | Apis mellifera | Tachykinin | APMGFQGMR-amide 1 | 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05611 | APMGFYGTR |
9 | Apis mellifera | Tachykinin | APMGFYGTR-amide | 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05612 | APTGHQEMQ |
9 | Apis mellifera | Tachykinin | APTGHQEMQ-amide | 12752663#Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; #Insect Mol. Biol. 12:291-298(2003). | |
| NP05613 | ARMGFHGMR |
9 | Apis mellifera | Tachykinin | ARMGFHGMR-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05614 | APMGFYGT |
8 | Apis mellifera | Tachykinin | Brain peptide APMGFYGT | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05615 | ASFDDEYY |
8 | Apis mellifera | Tachykinin | Brain peptide ASFDDEYY | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05616 | EILDEI |
6 | Apis mellifera | Tachykinin | Brain peptide EILDEI | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05617 | GVMDFQIGLQ |
10 | Apis mellifera | Tachykinin | Brain peptide GVMDFQIGLQ | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05618 | IILDALEELD |
10 | Apis mellifera | Tachykinin | Brain peptide IILDALEELD | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05619 | ILDALEELD |
9 | Apis mellifera | Tachykinin | Brain peptide ILDALEELD | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05620 | NSIINDVKNELFPEDIN |
17 | Apis mellifera | Tachykinin | Brain peptide NSIINDVKNELFPEDIN | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05621 | SLEEILDEI |
9 | Apis mellifera | Tachykinin | Brain peptide SLEEILDEI | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05622 | SLEEILDEIK |
10 | Apis mellifera | Tachykinin | Brain peptide SLEEILDEIK | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05623 | VLSMDGYQNILDKKDELLGEWE |
22 | Apis mellifera | Tachykinin | Brain peptide VLSMDGYQNILDKKDELLGEWE | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05624 | NPRWEFRGKFVGVR |
14 | Apis mellifera | Tachykinin | NPRWEFRGKFVGVR-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05625 | SPFRYLGAR |
9 | Apis mellifera | Tachykinin | SPFRYLGAR-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05626 | TTRFQDSRSKDVYLIDYPEDY |
21 | Apis mellifera | Tachykinin | TTRFQDSRSKDVYLIDYPEDY-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05627 | GPSGFLGMR |
9 | Banasa dimidiata | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05628 | APAAGFFGMR |
10 | Banasa dimidiata | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05629 | GPSSGFFGMR |
10 | Banasa dimidiata | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05630 | SPASGFFGMR |
10 | Banasa dimidiata | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05631 | APLMGFQGVR |
10 | Banasa dimidiata | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05632 | APSMGFMGMR |
10 | Banasa dimidiata | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05633 | ALNSVAYERSVMQDYE |
16 | Bos taurus | Tachykinin | C-terminal-flanking peptide | 2809597#McGregor G.P., Kage R., Thim L., Conlon J.M.; #Quantitation and characterization of peptides from the C-terminal flanking region of rat and bovine preprotachykinins.; #J. Neurochem. 53:1871-1877(1989). | |
| NP05634 | HKTDSFVGLM |
10 | Bos taurus | Tachykinin | Neurokinin A | ||
| NP05635 | DADSSIEKQVALLKALYGHGQLSHKRHKTDSFVGLM |
36 | Bos taurus | Tachykinin | Neuropeptide K | ||
| NP05636 | RPKPQQFFGLM |
11 | Bos taurus | Tachykinin | Substance P | ||
| NP05637 | DMHDFFVGLM |
10 | Bos taurus | Tachykinin | Neurokinin-B | ||
| NP05638 | APTAFYGVR |
9 | Calliphora vomitoria | Tachykinin | Callitachykinin-1 | 7984492#Lundquist C.T., Clottens F.L., Holman G.M., Nichols R., Nachman R.J., Naessel D.R.; #Callitachykinin I and II, two novel myotropic peptides isolated from the blowfly, Calliphora vomitoria, that have resemblances to tachykinins.; #Peptides 15:761-768(1994). | |
| NP05639 | GLGNNAFVGVR |
11 | Calliphora vomitoria | Tachykinin | Callitachykinin-2 | 7984492#Lundquist C.T., Clottens F.L., Holman G.M., Nichols R., Nachman R.J., Naessel D.R.; #Callitachykinin I and II, two novel myotropic peptides isolated from the blowfly, Calliphora vomitoria, that have resemblances to tachykinins.; #Peptides 15:761-768(1994). | |
| NP05640 | GKRSQEEPESYEWGTVQIYDKRR |
23 | Carassius auratus | Tachykinin | C-terminal-flanking peptide | ||
| NP05641 | HKINSFVGLM |
10 | Carassius auratus | Tachykinin | Neurokinin A | ||
| NP05642 | SPANAQITRKRHKINSFVGLM |
21 | Carassius auratus | Tachykinin | Neuropeptide gamma | 2002352#Conlon J.M., O'Harte F., Peter R.E., Kah O.; #Carassin: a tachykinin that is structurally related to neuropeptide- gamma from the brain of the goldfish.; #J. Neurochem. 56:1432-1436(1991). | |
| NP05643 | KPRPHQFIGLM |
11 | Carassius auratus | Tachykinin | Substance P | ||
| NP05644 | RPKPQQFFGLM |
11 | Cavia porcellus | Tachykinin | Substance P | 2478925#Murphy R.; #Primary amino acid sequence of guinea-pig substance P.; #Neuropeptides 14:105-110(1989). | |
| NP05645 | TPTAFYGVR |
9 | Delia radicum | Tachykinin | Tachykinin-related peptide TPTAFYGVR-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
| NP05646 | GLGNNAFLGVR |
11 | Delia radicum | Tachykinin | Tachykinin-related peptide GLGNNAFLGVR-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
| NP05647 | DEEHDTSEGNWLGSGPDPLDYADEEADSSYAEN |
33 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 1(Potential) | ||
| NP05648 | FIPINNRLSDVLQSLEEERLRDSLLQDFFDRVAGRDGSAV |
40 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 2(Potential) | ||
| NP05649 | PALLAGDDDAEADEATELQQ |
20 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 3(Potential) | ||
| NP05650 | DVSHQHY |
7 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 4(Potential) | ||
| NP05651 | AALSDSYDLRGKQQRFADFNSKFVAVR |
27 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 5(Potential) | ||
| NP05652 | SDLEGNGVGIGDDHEQALVHPWLYLWGE |
28 | Drosophila melanogaster | Tachykinin | Tachykinin-associated peptide 6(Potential) | ||
| NP05653 | APTSSFIGMR |
10 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 1 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05654 | APLAFVGLR |
9 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 2 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05655 | APTGFTGMR |
9 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 3 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05656 | APVNSFVGMR |
10 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 4 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05657 | APNGFLGMR |
9 | Drosophila melanogaster | Tachykinin | Tachykinin-related peptide 5 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP05658 | EDEKDQRAADWMGPDPLDYADMDEDSIYYEN |
31 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-associated peptide 1(Potential) | ||
| NP05659 | YIPISNRLSDVLHQIEEQRMRENLLEDLFERLAAGDDSVGDV |
42 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-associated peptide 2(Potential) | ||
| NP05660 | PMSGDDDDNDAMELLQ |
16 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-associated peptide 3(Potential) | ||
| NP05661 | DVSHQHY |
7 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-associated peptide 4(Potential) | ||
| NP05662 | AALSEAYDVRGKKERYADFNSKFVAVR |
27 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-associated peptide 5(Potential) | ||
| NP05663 | SEQEAGLDTGDGDGDQQYLVRPWLYLWADN |
30 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-associated peptide 6(Potential) | ||
| NP05664 | APTSSFIGMR |
10 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-related peptide 1 (Potential) | ||
| NP05665 | APMSFVGMR |
9 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-related peptide 2 (Potential) | ||
| NP05666 | APTGFTGMR |
9 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-related peptide 3 (Potential) | ||
| NP05667 | APVNSFLGVR |
10 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-related peptide 4 (Potential) | ||
| NP05668 | APSGFQGMR |
9 | Drosophila pseudoobscura pseudoobscura | Tachykinin | Tachykinin-related peptide 5 (Potential) | ||
| NP05669 | QPSKDAFIGLM |
11 | Eledone cirrhosa | Tachykinin | Eledoisin | 14012712#Anastasi A., Erspamer V.; #The isolation and amino acid sequence of eledoisin, the active endecapeptide of the posterior salivary glands of Eledone.; #Arch. Biochem. Biophys. 101:56-65(1963). | |
| NP05670 | QPSKDAFIGLM |
11 | Eledone moschata | Tachykinin | Eledoisin | 14012712#Anastasi A., Erspamer V.; #The isolation and amino acid sequence of eledoisin, the active endecapeptide of the posterior salivary glands of Eledone.; #Arch. Biochem. Biophys. 101:56-65(1963). | |
| NP05671 | RPKPQQFFGLM |
11 | Equus caballus | Tachykinin | Substance P | #Studer R.O., Trzeciak A., Lergier W.; #Isolation and amino-acid sequence of substance P from horse intestine.; #Helv. Chim. Acta 56:860-866(1973). | |
| NP05672 | GPSGFLGMR |
9 | Euschistus servus | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05673 | APAAGFFGMR |
10 | Euschistus servus | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05674 | GPSSGFFGMR |
10 | Euschistus servus | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05675 | SPASGFFGMR |
10 | Euschistus servus | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05676 | APLMGFQGVR |
10 | Euschistus servus | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05677 | APSMGFMGMR |
10 | Euschistus servus | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05678 | KPRPQQFIGLM |
11 | Gadus morhua | Tachykinin | Substance P | 1376687#Jensen J., Conlon J.M.; #Substance-P-related and neurokinin-A-related peptides from the brain of the cod and trout.; #Eur. J. Biochem. 206:659-664(1992). | |
| NP05679 | HKINSFVGLM |
10 | Gadus morhua | Tachykinin | Neurokinin A | 1376687#Jensen J., Conlon J.M.; #Substance-P-related and neurokinin-A-related peptides from the brain of the cod and trout.; #Eur. J. Biochem. 206:659-664(1992). | |
| NP05680 | RPRPQQFFGLM |
11 | Gallus gallus | Tachykinin | Substance P | 2452461#Conlon J.M., Katsoulis S., Schmidt W.E., Thim L.; #[Arg3]substance P and neurokinin A from chicken small intestine.; #Regul. Pept. 20:171-180(1988). | |
| NP05681 | HKTDSFVGLM |
10 | Gallus gallus | Tachykinin | Neurokinin A | 2452461#Conlon J.M., Katsoulis S., Schmidt W.E., Thim L.; #[Arg3]substance P and neurokinin A from chicken small intestine.; #Regul. Pept. 20:171-180(1988). | |
| NP05682 | ALNSVAYERSAMQNYE |
16 | Homo sapiens | Tachykinin | C-terminal-flanking peptide | 2284201#McGregor G.P., Conlon J.M.;#Characterization of the C-terminal flanking peptide of human beta-preprotachykinin.;#Peptides 11:907-910(1990). | |
| NP05683 | HKTDSFVGLM |
10 | Homo sapiens | Tachykinin | Neurokinin A | 3038549#Theodorsson-Norheim E., Joernvall H., Andersson M., Norheim I., Oeberg K., Jacobsson G.;#Isolation and characterization of neurokinin A, neurokinin A(3-10) and neurokinin A(4-10) from a neutral water extract of a metastatic ileal carcinoid tumour.;#Eur. J. Biochem. 166:693-697(1987). | |
| NP05684 | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM |
36 | Homo sapiens | Tachykinin | Neuropeptide K | ||
| NP05685 | RPKPQQFFGLM |
11 | Homo sapiens | Tachykinin | Substance P | ||
| NP05686 | DMHDFFVGLM |
10 | Homo sapiens | Tachykinin | Neurokinin-B | ||
| NP05687 | DEPKPDQFVGLM |
12 | Kassina maculata | Tachykinin | Hylambates kassinin | #Yasuhara T., Nakajima T., Erspamer G.F., Erspamer V.; #New tachykinins, Glu2, Pro5-kassinin (hylambates-kassinin) and hylambatin, in the skin of the African rhacophorid frog Hylambates maculatus.; #Biomed. Res. 2:613-617(1981). | |
| NP05688 | DPPDPDRFYGMM |
12 | Kassina maculata | Tachykinin | Hylambatin | #Yasuhara T., Nakajima T., Erspamer G.F., Erspamer V.; #New tachykinins, Glu2, Pro5-kassinin (hylambates-kassinin) and hylambatin, in the skin of the African rhacophorid frog Hylambates maculatus.; #Biomed. Res. 2:613-617(1981). | |
| NP05689 | DVPKSDQFVGLM |
12 | Kassina senegalensis | Tachykinin | Kassinin | 891753#Anastasi A., Montecucchi P.C., Erspamer V., Visser J.; #Amino acid composition and sequence of kassinin, a tachykinin dodecapeptide from the skin of the African frog Kassina senegalensis.; #Experientia 33:857-858(1977). | |
| NP05690 | KPSPDRFYGLM |
11 | Lithobates catesbeiana | Tachykinin | Ranatachykinin-A | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #"Four novel tachykinins in frog (Rana catesbeiana) brain and intestine."; #Regul. Pept. 46:81-88(1993). | |
| NP05691 | YKSDSFYGLM |
10 | Lithobates catesbeiana | Tachykinin | Ranatachykinin-B | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #Four novel tachykinins in frog (Rana catesbeiana) brain and intestine.; #Regul. Pept. 46:81-88(1993). | |
| NP05692 | HNPASFIGLM |
10 | Lithobates catesbeiana | Tachykinin | Ranatachykinin C | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #Four novel tachykinins in frog (Rana catesbeiana) brain and intestine.; #Regul. Pept. 46:81-88(1993). | |
| NP05693 | KPNPERFYAPM |
11 | Lithobates catesbeiana | Tachykinin | Ranatachykinin-D | 2043143#Kozawa H., Hino J., Minamino N., Kangawa K., Matsuo H.; #Isolation of four novel tachykinins from frog (Rana catesbeiana) brain and intestine.; #Biochem. Biophys. Res. Commun. 177:588-595(1991).$8210506#Kangawa K., Kozawa H., Hino J., Minamino N., Matsuo H.; #"Four novel tachykinins in frog (Rana catesbeiana) brain and intestine."; #Regul. Pept. 46:81-88(1993). | |
| NP05694 | GPSGFYGVR |
9 | Locusta migratoria | Tachykinin | Locustatachykinin-1 | 2311766#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Locustatachykinin I and II, two novel insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #FEBS Lett. 261:397-401(1990). | |
| NP05695 | APLSGFYGVR |
10 | Locusta migratoria | Tachykinin | Locustatachykinin-2 | 2311766#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Locustatachykinin I and II, two novel insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #FEBS Lett. 261:397-401(1990). | |
| NP05696 | APQAGFYGVR |
10 | Locusta migratoria | Tachykinin | Locustatachykinin-3 | 2132575#Schoofs L., Holman G.M., Hayes T.K., Kochansky J.P., Nachman R.J., de Loof A.; #Locustatachykinin III and IV: two additional insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #Regul. Pept. 31:199-212(1990). | |
| NP05697 | APSLGFHGVR |
10 | Locusta migratoria | Tachykinin | Locustatachykinin-4 | 2132575#Schoofs L., Holman G.M., Hayes T.K., Kochansky J.P., Nachman R.J., de Loof A.; #Locustatachykinin III and IV: two additional insect neuropeptides with homology to peptides of the vertebrate tachykinin family.; #Regul. Pept. 31:199-212(1990). | |
| NP05698 | ALNSVAFERSAMQNYE |
16 | Mesocricetus auratus | Tachykinin | C-terminal-flanking peptide (Bysimilarity) | ||
| NP05699 | HKTDSFVGLM |
10 | Mesocricetus auratus | Tachykinin | Neurokinin A | ||
| NP05700 | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM |
36 | Mesocricetus auratus | Tachykinin | Neuropeptide K | ||
| NP05701 | RPKPQQFFGLM |
11 | Mesocricetus auratus | Tachykinin | Substance P | ||
| NP05702 | ALNSVAYERSAMQNYE |
16 | Mus musculus | Tachykinin | C-terminal-flanking peptide (Bysimilarity) | ||
| NP05703 | HKTDSFVGLM |
10 | Mus musculus | Tachykinin | Neurokinin A | ||
| NP05704 | DADSSVEKQVALLKALYGHGQISHKRHKTDSFVGLM |
36 | Mus musculus | Tachykinin | Neuropeptide K | ||
| NP05705 | RPKPQQFFGLM |
11 | Mus musculus | Tachykinin | Substance P | ||
| NP05706 | DMHDFFVGLM |
10 | Mus musculus | Tachykinin | Neurokinin-B | ||
| NP05707 | GPSGFLGMR |
9 | Nezara viridula | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05708 | APAAGFFGMR |
10 | Nezara viridula | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05709 | GPSSGFFGMR |
10 | Nezara viridula | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05710 | SPASGFFGMR |
10 | Nezara viridula | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05711 | APLMGFQGVR |
10 | Nezara viridula | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05712 | APSMGFMGMR |
10 | Nezara viridula | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05713 | KPPSSSEFIGLM |
12 | Octopus vulgaris | Tachykinin | Tachykinin-1 | 12576083#Kanda A., Iwakoshi-Ukena E., Takuwa-Kuroda K., Minakata H.; #Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris.; #Peptides 24:35-43(2003). | |
| NP05714 | KPPSSSEFVGLM |
12 | Octopus vulgaris | Tachykinin | Tachykinin-2 | 12576083#Kanda A., Iwakoshi-Ukena E., Takuwa-Kuroda K., Minakata H.; #Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris.; #Peptides 24:35-43(2003). | |
| NP05715 | DDASDRAKKFYGLM |
14 | Odorrana margaretae | Tachykinin | Ranamargarin | 2803524#Tang Y.Q., Tian S.H., Wu S.X., Hua J.C., Wu G.F., Zhao E.M., Lu Y.A., Zhu Y.Q., Zou G., Tsou K.; #Isolation and structure of ranamargarin, a new tachykinin from the skin of Chinese frog Rana margaratae.; #Sci. China, Ser. B, Chem. Life Sci. Earth Sci. 32:570-579(1989). | |
| NP05716 | GPSGFLGMR |
9 | Oncopeltus fasciatus | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05717 | APASGFFGMR |
10 | Oncopeltus fasciatus | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05718 | APSSGFFGTR |
10 | Oncopeltus fasciatus | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05719 | NPASGFFGMR |
10 | Oncopeltus fasciatus | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05720 | APVMGFQGMR |
10 | Oncopeltus fasciatus | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05721 | APSMGFMGMR |
10 | Oncopeltus fasciatus | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05722 | KPRPHQFFGLM |
11 | Oncorhynchus mykiss | Tachykinin | Substance P | 1376687#Jensen J., Conlon J.M.; #Substance-P-related and neurokinin-A-related peptides from the brain of the cod and trout.; #Eur. J. Biochem. 206:659-664(1992). | |
| NP05723 | HKINSFVGLM |
10 | Oncorhynchus mykiss | Tachykinin | Neurokinin A | 1376687#Jensen J., Conlon J.M.; #Substance-P-related and neurokinin-A-related peptides from the brain of the cod and trout.; #Eur. J. Biochem. 206:659-664(1992). | |
| NP05724 | ALNSVAYERSAMQNYE |
16 | Oryctolagus cuniculus | Tachykinin | C-terminal-flanking peptide | ||
| NP05725 | HKTDSFVGLM |
10 | Oryctolagus cuniculus | Tachykinin | Neurokinin A | ||
| NP05726 | DAGHGQISHKRHKTDSFVGLM |
21 | Oryctolagus cuniculus | Tachykinin | Neuropeptide gamma | #Kage R., McGregor G.P., Thim L., Conlon J.M.; #Gamma-neuropeptide K: a peptide isolated from rabbit gut that is derived from gamma-preprotachykinin.; #Regul. Pept. 18:346-346(1987). | |
| NP05727 | RPKPQQFFGLM |
11 | Oryctolagus cuniculus | Tachykinin | Substance P | ||
| NP05728 | KPNPERFYGLM |
11 | Pelophylax ridibundus | Tachykinin | Ranakinin | 1658233#O'Harte F., Burcher E., Lovas S., Smith D.D., Vaudry H., Conlon J.M.; #Ranakinin: a novel NK1 tachykinin receptor agonist isolated with neurokinin B from the brain of the frog Rana ridibunda.; #J. Neurochem. 57:2086-2091(1991). | |
| NP05729 | HKLDSFIGLM |
10 | Pelophylax ridibundus | Tachykinin | Neurokinin A | 1332683#Wang Y., Badgery-Parker T., Lovas S., Chartrel N., Vaudry H., Burcher E., Conlon J.M.; #Primary structure and receptor-binding properties of a neurokinin A- related peptide from frog gut.; #Biochem. J. 287:827-832(1992). | |
| NP05730 | DMHDFFVGLM |
10 | Pelophylax ridibundus | Tachykinin | Neurokinin-B | 1658233#O'Harte F., Burcher E., Lovas S., Smith D.D., Vaudry H., Conlon J.M.; #Ranakinin: a novel NK1 tachykinin receptor agonist isolated with neurokinin B from the brain of the frog Rana ridibunda.; #J. Neurochem. 57:2086-2091(1991). | |
| NP05731 | GPSGFLGMR |
9 | Pentatoma rufipes | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05732 | APAAGFFGMR |
10 | Pentatoma rufipes | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05733 | GPSSGFFGMR |
10 | Pentatoma rufipes | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05734 | SPASGFFGMR |
10 | Pentatoma rufipes | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05735 | APLMGFQGVR |
10 | Pentatoma rufipes | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05736 | APSMGFMGMR |
10 | Pentatoma rufipes | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05737 | QNPNRFIGLM |
10 | Phyllomedusa bicolor | Tachykinin | Phyllomedusin | 5452018#Anastasi A., Erspamer G.F.; #Occurrence of phyllomedusin, a physalaemin-like decapeptide, in the skin of Phyllomedusa bicolor.; #Experientia 26:866-867(1970). | |
| NP05738 | QADPNKFYGLM |
11 | Physalaemus fuscomaculatus | Tachykinin | Physalaemin | 5857249#Erspamer V., Anastasi A., Bertaccini G., Cei J.M.; #Structure and pharmacological actions of physalaemin, the main active polypeptide of the skin of Physalaemus fuscumaculatus.; #Experientia 20:489-490(1964). | |
| NP05739 | QPHPDEFVGLM |
11 | Pseudophryne guentheri | Tachykinin | Kassinin-like peptide K-I | 2356157#Simmaco M., Severini C., de Biase D., Barra D., Bossa F., Roberts J.D., Melchiorri P., Erspamer V.; #Six novel tachykinin- and bombesin-related peptides from the skin of the Australian frog Pseudophryne guntheri.; #Peptides 11:299-304(1990). | |
| NP05740 | QPNPDEFVGLM |
11 | Pseudophryne guentheri | Tachykinin | Kassinin-like peptide K-II | 2356157#Simmaco M., Severini C., de Biase D., Barra D., Bossa F., Roberts J.D., Melchiorri P., Erspamer V.; #Six novel tachykinin- and bombesin-related peptides from the skin of the Australian frog Pseudophryne guntheri.; #Peptides 11:299-304(1990). | |
| NP05741 | QPHPNEFVGLM |
11 | Pseudophryne guentheri | Tachykinin | Kassinin-like peptide K-III | 2356157#Simmaco M., Severini C., de Biase D., Barra D., Bossa F., Roberts J.D., Melchiorri P., Erspamer V.; #Six novel tachykinin- and bombesin-related peptides from the skin of the Australian frog Pseudophryne guntheri.; #Peptides 11:299-304(1990). | |
| NP05742 | QPNPDEFFGLM |
11 | Pseudophryne guentheri | Tachykinin | Substance P-like peptide 1 | 2356157#Simmaco M., Severini C., de Biase D., Barra D., Bossa F., Roberts J.D., Melchiorri P., Erspamer V.; #Six novel tachykinin- and bombesin-related peptides from the skin of the Australian frog Pseudophryne guntheri.; #Peptides 11:299-304(1990). | |
| NP05743 | QPNPNEFFGLM |
11 | Pseudophryne guentheri | Tachykinin | Substance P-like peptide 2 | 2356157#Simmaco M., Severini C., de Biase D., Barra D., Bossa F., Roberts J.D., Melchiorri P., Erspamer V.; #Six novel tachykinin- and bombesin-related peptides from the skin of the Australian frog Pseudophryne guntheri.; #Peptides 11:299-304(1990). | |
| NP05744 | GPSGFLGMR |
9 | Pyrrhocoris apterus | Tachykinin | Tachykinin-related peptide 1 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05745 | APASGFFGMR |
10 | Pyrrhocoris apterus | Tachykinin | Tachykinin-related peptide 2 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05746 | GPSSGFFGTR |
10 | Pyrrhocoris apterus | Tachykinin | Tachykinin-related peptide 3 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05747 | TPASGFFGMR |
10 | Pyrrhocoris apterus | Tachykinin | Tachykinin-related peptide 4 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05748 | APVMGFQGMR |
10 | Pyrrhocoris apterus | Tachykinin | Tachykinin-related peptide 5 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05749 | APSSMGFMGMR |
11 | Pyrrhocoris apterus | Tachykinin | Tachykinin-related peptide 6 | 19084564#Neupert S., Russell W.K., Russell D.H., Lopez J.D. Jr., Predel R., Nachman R.J.; #Neuropeptides in Heteroptera: identification of allatotropin-related peptide and tachykinin-related peptides using MALDI-TOF mass spectrometry.; #Peptides 30:483-488(2009). | |
| NP05750 | ALNSVAYERSAMQNYE |
16 | Rattus norvegicus | Tachykinin | C-terminal-flanking peptide | ||
| NP05751 | HKTDSFVGLM |
10 | Rattus norvegicus | Tachykinin | Neurokinin A | ||
| NP05752 | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM |
36 | Rattus norvegicus | Tachykinin | Neuropeptide K | ||
| NP05753 | RPKPQQFFGLM |
11 | Rattus norvegicus | Tachykinin | Substance P | ||
| NP05754 | DMHDFFVGLM |
10 | Rattus norvegicus | Tachykinin | Neurokinin-B | ||
| NP05755 | SGPGFMGVR |
9 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 1 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05756 | TSMGFQGVR |
9 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 2 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05757 | APASGFFGMR |
10 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 3 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05758 | ASGFFGMR |
8 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 3(3-10) | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05759 | SGFFGMR |
7 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 3(4-10) | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05760 | TPSDGFMGMR |
10 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 4 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05761 | APACVGFQGMR |
11 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 5 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05762 | GPSSSAFFGMR |
11 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 6 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05763 | SPATMGFAGVR |
11 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 7 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05764 | QERRAMGFVGMR |
12 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 8 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05765 | FVGMR |
5 | Rhodnius prolixus | Tachykinin | Tachykinin-related peptide 8(8-12) | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05766 | APSGFLGVR |
9 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 1 | 8897641#Muren J.E., Naessel D.R.; #Isolation of five tachykinin-related peptides from the midgut of the cockroach Leucophaea maderae: existence of N-terminally extended isoforms.; #Regul. Pept. 65:185-196(1996). | |
| NP05767 | APEESPKRAPSGFLGVR |
17 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 2 | 8897641#Muren J.E., Naessel D.R.; #Isolation of five tachykinin-related peptides from the midgut of the cockroach Leucophaea maderae: existence of N-terminally extended isoforms.; #Regul. Pept. 65:185-196(1996). | |
| NP05768 | NGERAPGSKKAPSGFLGTR |
19 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 3 | 8897641#Muren J.E., Naessel D.R.; #Isolation of five tachykinin-related peptides from the midgut of the cockroach Leucophaea maderae: existence of N-terminally extended isoforms.; #Regul. Pept. 65:185-196(1996). | |
| NP05769 | APSGFMGMR |
9 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 4 | 8897641#Muren J.E., Naessel D.R.; #Isolation of five tachykinin-related peptides from the midgut of the cockroach Leucophaea maderae: existence of N-terminally extended isoforms.; #Regul. Pept. 65:185-196(1996). | |
| NP05770 | APAMGFQGVR |
10 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 5 | 8897641#Muren J.E., Naessel D.R.; #Isolation of five tachykinin-related peptides from the midgut of the cockroach Leucophaea maderae: existence of N-terminally extended isoforms.; #Regul. Pept. 65:185-196(1996).$9114447#Muren J.E., Naessel D.R.; #Seven tachykinin-related peptides isolated from the brain of the madeira cockroach; evidence for tissue-specific expression of isoforms.; #Peptides 18:7-15(1997). | |
| NP05771 | APAAGFFGMR |
10 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 6 | 9114447#Muren J.E., Naessel D.R.; #Seven tachykinin-related peptides isolated from the brain of the madeira cockroach; evidence for tissue-specific expression of isoforms.; #Peptides 18:7-15(1997). | |
| NP05772 | VPASGFFGMR |
10 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 7 | 9114447#Muren J.E., Naessel D.R.; #Seven tachykinin-related peptides isolated from the brain of the madeira cockroach; evidence for tissue-specific expression of isoforms.; #Peptides 18:7-15(1997). | |
| NP05773 | GPSMGFHGMR |
10 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 8 | 9114447#Muren J.E., Naessel D.R.; #Seven tachykinin-related peptides isolated from the brain of the madeira cockroach; evidence for tissue-specific expression of isoforms.; #Peptides 18:7-15(1997). | |
| NP05774 | APSMGFQGMR |
10 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 9 | 9114447#Muren J.E., Naessel D.R.; #Seven tachykinin-related peptides isolated from the brain of the madeira cockroach; evidence for tissue-specific expression of isoforms.; #Peptides 18:7-15(1997). | |
| NP05775 | SGLDSLSGATFGGNR |
15 | Rhyparobia maderae | Tachykinin | Tachykinin-related peptide 10 | 9114447#Muren J.E., Naessel D.R.; #Seven tachykinin-related peptides isolated from the brain of the madeira cockroach; evidence for tissue-specific expression of isoforms.; #Peptides 18:7-15(1997). | |
| NP05776 | GNTKKAVPGFYGTR |
14 | Schistocerca gregaria | Tachykinin | Tachykinin-1 | 10581195#Veelaert D., Baggerman G., Derua R., Waelkens E., Meeusen T., Vande Water G., De Loof A., Schoofs L.; #Identification of a new tachykinin from the midgut of the desert locust, Schistocerca gregaria, by ESI-Qq-oa-TOF mass spectrometry.; #Biochem. Biophys. Res. Commun. 266:237-242(1999). | |
| NP05777 | AKFDKFYGLM |
10 | Scyliorhinus canicula | Tachykinin | Scyliorhinin-1 | 2422058#Conlon J.M., Deacon C.F., O'Toole L., Thim L.; #Scyliorhinin I and II: two novel tachykinins from dogfish gut.; #FEBS Lett. 200:111-116(1986).$7685693#Waugh D., Wang Y., Hazon N., Balment R.J., Conlon J.M.; #Primary structures and biological activities of substance-P-related peptides from the brain of the dogfish, Scyliorhinus canicula.; #Eur. J. Biochem. 214:469-474(1993). | |
| NP05778 | SPSNSKCPDGPDCFVGLM |
18 | Scyliorhinus canicula | Tachykinin | Scyliorhinin-2 | 2422058#Conlon J.M., Deacon C.F., O'Toole L., Thim L.; #Scyliorhinin I and II: two novel tachykinins from dogfish gut.; #FEBS Lett. 200:111-116(1986).$7541963#Anderson W.G., Conlon J.M., Hazon N.; #"Characterization of the endogenous intestinal peptide that stimulates the rectal gland of Scyliorhinus canicula."; #Am. J. Physiol. 268:R1359-R1364(1995). | |
| NP05779 | KPRPGQFFGLM |
11 | Scyliorhinus canicula | Tachykinin | Substance P | 7685693#Waugh D., Wang Y., Hazon N., Balment R.J., Conlon J.M.; #Primary structures and biological activities of substance-P-related peptides from the brain of the dogfish, Scyliorhinus canicula.; #Eur. J. Biochem. 214:469-474(1993). | |
| NP05780 | DMHDFFVGLM |
10 | Sus scrofa | Tachykinin | Neurokinin-B | 6576785#Kangawa K., Minamino N., Fukuda A., Matsuo H.; #Neuromedin K: a novel mammalian tachykinin identified in porcine spinal cord.; #Biochem. Biophys. Res. Commun. 114:533-540(1983). | |
| NP05781 | SNSKCPDGPDCFVGLM |
16 | Torpedo marmorata | Tachykinin | Des[Ser(1)Pro(2)] scyliorhinin-2 | 2847952#Conlon J.M., Thim L.; #Isolation of the tachykinin, des[Ser1Pro2]scyliorhinin II from the intestine of the ray, Torpedo marmorata.; #Gen. Comp. Endocrinol. 71:383-388(1988). | |
| NP05782 | QADPNAFYGLM |
11 | Uperoleia inundata | Tachykinin | Uperin-11 | #Bradford A.M., Raftery M.J., Bowie J.H., Tyler M.J., Wallace J.C., Adams G.W., Severini C.; #Novel uperin peptides from the dorsal glands of the australian floodplain toadlet Uperoleia inundata.; #Aust. J. Chem. 49:475-484(1996). | |
| NP05783 | QPDPNAFYGLM |
11 | Uperoleia rugosa | Tachykinin | Uperolein | 1120493#Anastasi A., Erspamer V., Endean R.; #Structure of uperolein, a physalaemin-like endecapeptide occurring in the skin of Uperoleia rugosa and Uperoleia marmorata.; #Experientia 31:394-395(1975). | |
| NP05784 | QADPKTFYGLM |
11 | Uperoleia rugosa | Tachykinin | Rugosauperolein-2 | 7389029#Nakajima T., Yasuhara T., Erspamer V., Erspamer G.F., Negri L.; #Physalaemin- and bombesin-like peptides in the skin of the Australian leptodactylid frog Uperoleia rugosa.; #Chem. Pharm. Bull. 28:689-695(1980). | |
| NP05785 | LRQSQFVGSR |
10 | Urechis unicinctus | Tachykinin | Urechistachykinin-1 | 8476410#Ikeda T., Minakata H., Nomoto K., Kubota I., Muneoka Y.; #Two novel tachykinin-related neuropeptides in the echiuroid worm, Urechis unicinctus.; #Biochem. Biophys. Res. Commun. 192:1-6(1993). | |
| NP05786 | AAGMGFFGAR |
10 | Urechis unicinctus | Tachykinin | Urechistachykinin-2 | 8476410#Ikeda T., Minakata H., Nomoto K., Kubota I., Muneoka Y.; #Two novel tachykinin-related neuropeptides in the echiuroid worm, Urechis unicinctus.; #Biochem. Biophys. Res. Commun. 192:1-6(1993). |